Price Size
$350 100ul
$450 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    Phospho-MRLC1 (Thr19+Ser20) Antibody
  • Catalog No.
    AF8010
  • RRID
    AB_2840073
  • Source
    Rabbit
  • Application
    WB,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
  • UniProt
  • Mol.Wt
    18kD;
    20kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

20 kDa myosin light chain;Human 20kDa myosin light chain (MLC2) mRNA complete cds;LC20;MGC3505;MLC 2;MLC-2C;MLC2;MLY 9;MRLC1;MYL9;MYL9_HUMAN;Myosin light chain 9 regulatory;Myosin light polypeptide 9 regulatory;myosin regulatory light chain 1;Myosin regulatory light chain 2;Myosin regulatory light chain 2 smooth muscle isoform;Myosin regulatory light chain 9;Myosin regulatory light chain MRLC1;Myosin regulatory light polypeptide 9;Myosin RLC;Myosin vascular smooth muscle light chain 2;MYRL2;OTTHUMP00000030857;smooth muscle isoform; ML12B_HUMAN;MLC 2A;MLC-2;MLC-2a;MLC-B;MLC20;MRLC2;MYL12B;MYLC2B;Myosin light chain 12B regulatory;Myosin regulatory light chain 12B;myosin regulatory light chain 2;Myosin regulatory light chain 2-B;myosin regulatory light chain 2-B, smooth muscle isoform;Myosin regulatory light chain 20 kDa;Myosin regulatory light chain MRLC2;myosin, light chain 12B, regulatory;OTTHUMP00000162244;OTTHUMP00000165806;OTTHUMP00000165807;OTTHUMP00000165808;SHUJUN-1;smooth muscle isoform;

Applications:

WB 1:1000-3000, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Specificity:

Phospho-MRLC1 (Thr19+Ser20) Antibody detects endogenous levels of MRLC1 only when phosphorylated at Thr19+Ser20.

RRID:

AB_2840073
Please cite this product as: Affinity Biosciences Cat# AF8010, RRID:AB_2840073.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human MRLC1 around the phosphorylation site of Thr19+Ser20.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

MYL9

Molecular Weight:

Observed Mol.Wt.: 18kD.
Predicted Mol.Wt.: 20kDa(Calculated)..

Tissue Specificity:

P24844 MYL9_HUMAN:
Smooth muscle tissues and in some, but not all, nonmuscle cells.

Description:

Myosin is composed of six polypeptide chains: two identical heavy chains and two pairs of light chains. Myosin light chain 2 (MLC2), also known as myosin regulatory light chain (MRLC), RLC, or LC20, has many isoforms depending on its distribution. In smooth muscle, MLC2 is phosphorylated at Thr18 and Ser19 by myosin light chain kinase (MLCK) in a Ca2+/calmodulin-dependent manner (1). This phosphorylation is correlated with myosin ATPase activity and smooth muscle contraction (2). ROCK also phosphorylates Ser19 of smooth muscle MLC2, which regulates the assembly of stress fibers (3). Phosphorylation of smooth muscle MLC2 at Ser1/Ser2 and Ser9 by PKC and cdc2 has been reported to inhibit myosin ATPase activity (4,5). Phosphorylation by cdc2 controls the timing of cytokinesis (5). Transgenic mice lacking phosphorylation sites on the cardiac muscle isoform show morphological and functional abnormalities (6).

Sequence:
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

Research Background

Function:

Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion.

Post-translational Modifications:

Phosphorylation increases the actin-activated myosin ATPase activity and thereby regulates the contractile activity. It is required to generate the driving force in the migration of the cells but not necessary for localization of myosin-2 at the leading edge.

Tissue Specificity:

Smooth muscle tissues and in some, but not all, nonmuscle cells.

Subunit Structure:

Myosin is a hexamer of 2 heavy chains and 4 light chains: interacts with myosin heavy chain MYO19.

Research Fields

Research Fields:

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Tight junction.(View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.(View pathway)
· Environmental Information Processing > Signal transduction > cGMP-PKG signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > cAMP signaling pathway.(View pathway)
· Organismal Systems > Circulatory system > Vascular smooth muscle contraction.(View pathway)
· Organismal Systems > Immune system > Leukocyte transendothelial migration.(View pathway)
· Organismal Systems > Endocrine system > Oxytocin signaling pathway.

Reference Citations:

1). Wu J et al. Patchouli alcohol attenuates 5-fluorouracil-induced intestinal mucositis via TLR2/MyD88/NF-kB pathway and regulation of microbiota. Biomed Pharmacother 2020 Jan 28;124:109883 (PubMed: 32004938) [IF=4.545]

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF8010-BP
(Blocking peptide available as AF8010-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Horse
100%
Bovine
100%
Sheep
100%
Dog
100%
Xenopus
100%
Chicken
100%
Rabbit
100%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
P24844 as Substrate
Site PTM Type Enzyme
S2 Phosphorylation P17252 (PRKCA)
S3 Phosphorylation P17252 (PRKCA)
T10 Phosphorylation P17252 (PRKCA)
T11 Phosphorylation
T19 Phosphorylation O43293 (DAPK3) , O14578 (CIT) , Q15746 (MYLK) , Q5VT25 (CDC42BPA) , Q13464 (ROCK1)
S20 Phosphorylation O43293 (DAPK3) , Q5VT25 (CDC42BPA) , O75116 (ROCK2) , Q14012 (CAMK1) , Q15746 (MYLK) , Q13153 (PAK1) , Q13177 (PAK2) , Q9Y5S2 (CDC42BPB) , O14578 (CIT) , Q13464 (ROCK1)
S29 Phosphorylation
K51 Acetylation
K51 Ubiquitination
S60 Phosphorylation
T97 Phosphorylation
S115 Phosphorylation
T128 Phosphorylation
T135 Phosphorylation
Y143 Phosphorylation P00533 (EGFR)
K150 Ubiquitination
K151 Sumoylation
K151 Ubiquitination
Y156 Phosphorylation P00533 (EGFR)
K164 Ubiquitination
K168 Acetylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top