Price Size
$350 100ul
$450 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    Phospho-VAMP4 (Ser30) Antibody
  • Catalog No.
    AF8095
  • RRID
    AB_2840158
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig, Bovine, Horse, Sheep, Rabbit, Dog
  • UniProt
  • Mol.Wt
    16kD;
    16kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

VAMP 24; VAMP 4; VAMP-4; VAMP24; VAMP4; VAMP4 protein; VAMP4_HUMAN; Vesicle associated membrane protein 4; Vesicle associated membrane protein 4 isoform CRA a; Vesicle associated membrane protein 4 isoform CRA b; Vesicle-associated membrane protein 4;

Applications:

WB 1:1000-3000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig, Bovine, Horse, Sheep, Rabbit, Dog

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Specificity:

Phospho-VAMP4 (Ser30) Antibody detects endogenous levels of VAMP4 only when phosphorylated at Ser30.

RRID:

AB_2840158
Please cite this product as: Affinity Biosciences Cat# AF8095, RRID:AB_2840158.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human VAMP4 around the phosphorylation site of Ser30.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

VAMP4

Molecular Weight:

Observed Mol.Wt.: 16kD.
Predicted Mol.Wt.: 16kDa(Calculated)..

Sequence:
MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDKIKHVQNQVDEVIDVMQENITKVIERGERLDELQDKSESLSDNATAFSNRSKQLRRQMWWRGCKIKAIMALVAAILLLVIIILIVMKYRT

Research Background

Function:

Involved in the pathway that functions to remove an inhibitor (probably synaptotagmin-4) of calcium-triggered exocytosis during the maturation of secretory granules. May be a marker for this sorting pathway that is critical for remodeling the secretory response of granule.

Subcellular Location:

Golgi apparatus>trans-Golgi network membrane>Single-pass type IV membrane protein.
Note: Associated with trans Golgi network (TGN) and newly formed immature secretory granules (ISG). Not found on the mature secretory organelles.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Identified in a complex containing STX6, STX12, VAMP4 and VTI1A (By similarity). Interacts with BAIAP3; this interaction is increased in the presence of calcium.

Similarity:

Belongs to the synaptobrevin family.

Research Fields

Research Fields:

· Genetic Information Processing > Folding, sorting and degradation > SNARE interactions in vesicular transport.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF8095-BP
(Blocking peptide available as AF8095-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Horse
100%
Bovine
100%
Sheep
100%
Dog
100%
Rabbit
100%
Xenopus
0%
Zebrafish
0%
Chicken
0%
High similarity Medium similarity Low similarity No similarity
O75379 as Substrate
Site PTM Type Enzyme
S17 Phosphorylation
K19 Ubiquitination
S30 Phosphorylation P68400 (CSNK2A1)
K73 Ubiquitination
K87 Ubiquitination
S88 Phosphorylation
S90 Phosphorylation
S92 Phosphorylation
Y139 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top