Price Size
$350 100ul
$450 200ul

Same day delivery

Contact distributor
  • Product Name
    Phospho-TPPP (Ser18) Antibody
  • Catalog No.
    AF8329
  • RRID
    AB_2840391
  • Source
    Rabbit
  • Application
    WB,ELISA
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig(100%), Bovine(89%), Dog(100%)
  • UniProt
  • Mol.Wt
    (Observed)24kD; (Calculated)24kDa
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

25 kDa brain specific protein; 25 kDa brain-specific protein; Brain specific protein p25 alpha; Glycogen synthase kinase 3 (GSK3) inhibitor p24; OTTHUMP00000161630; p24; p25; p25-alpha; p25alpha; TPPP; TPPP/p25; TPPP_HUMAN; TPPP1; Tubulin polymerization promoting protein; Tubulin polymerization-promoting protein;

Applications:

WB 1:1000-3000, ELISA(peptide) 1:20000-1:40000

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig(100%), Bovine(89%), Dog(100%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Specificity:

Phospho-TPPP (Ser18) Antibody detects endogenous levels of TPPP only when phosphorylated at Ser18.

RRID:

AB_2840391
Please cite this product as: Affinity Biosciences Cat# AF8329, RRID:AB_2840391.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human TPPP around the phosphorylation site of Ser18.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

TPPP

Molecular Weight:

Observed Mol.Wt.: (Observed)24kD.
Predicted Mol.Wt.: (Calculated)24kDa.

Subcellular Location:

Cytoplasm. Cytoplasm, cytoskeleton. Nucleus. Localizes to glial Lewy bodies in the brains of individuals with synucleinopathies.

Tissue Specificity:

O94811 TPPP_HUMAN:
Widely expressed.

Sequence:
MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK

Research Background

Function:

Regulator of microtubule dynamics that plays a key role in myelination by promoting elongation of the myelin sheath (PubMed:31522887). Acts as a microtubule nucleation factor in oligodendrocytes: specifically localizes to the postsynaptic Golgi apparatus region, also named Golgi outpost, and promotes microtubule nucleation, an important step for elongation of the myelin sheath (PubMed:31522887). Required for both uniform polarized growth of distal microtubules as well as directing the branching of proximal processes (PubMed:31522887). Shows magnesium-dependent GTPase activity; the role of the GTPase activity is unclear (PubMed:21995432, PubMed:21316364). In addition to microtubule nucleation activity, also involved in microtubule bundling and stabilization of existing microtubules, thereby maintaining the integrity of the microtubule network (PubMed:17105200, PubMed:17693641, PubMed:18028908, PubMed:26289831). Regulates microtubule dynamics by promoting tubulin acetylation: acts by inhibiting the tubulin deacetylase activity of HDAC6 (PubMed:20308065, PubMed:23093407). Also regulates cell migration: phosphorylation by ROCK1 inhibits interaction with HDAC6, resulting in increased acetylation of tubulin and increased cell motility (PubMed:23093407). Plays a role in cell proliferation by regulating the G1/S-phase transition (PubMed:23355470). Involved in astral microtubule organization and mitotic spindle orientation during early stage of mitosis; this process is regulated by phosphorylation by LIMK2 (PubMed:22328514).

Post-translational Modifications:

Phosphorylated by LIMK1 on serine residues; phosphorylation may alter the tubulin polymerization activity (PubMed:17693641, PubMed:18028908). Phosphorylation by LIMK2, but not LIMK1, regulates astral microtubule organization at early stage of mitosis (PubMed:22328514). Phosphorylation by ROCK1 at Ser-32, Ser-107 and Ser-159 inhibits interaction with HDAC6, resulting in increased acetylation of tubulin, increased cell motility and entry into S-phase (PubMed:23093407, PubMed:23355470). Phosphorylation by CDK1 inhibits the microtubule polymerizing activity (PubMed:23355470).

Degraded by the proteasome; zinc-binding inhibits degradation by the proteasome.

Subcellular Location:

Postsynaptic Golgi apparatus. Cytoplasm>Cytoskeleton>Microtubule organizing center. Cytoplasm>Cytoskeleton. Nucleus. Cytoplasm>Cytoskeleton>Spindle.
Note: Specifically localizes to the postsynaptic Golgi apparatus region, also named Golgi outpost, which shapes dendrite morphology by functioning as sites of acentrosomal microtubule nucleation (By similarity). Mainly localizes to the cytoskeleton (PubMed:18028908). Also found in the nucleus; however, nuclear localization is unclear and requires additional evidences (PubMed:18028908). Localizes to glial Lewy bodies in the brains of individuals with synucleinopathies (PubMed:15590652, PubMed:17027006). During mitosis, colocalizes with LIMK2 at the mitotic spindle (PubMed:22328514).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Widely expressed.

Subunit Structure:

Homodimer (PubMed:17693641, PubMed:22484033, PubMed:26289831). Binds tubulin; binding is inhibited by GTP (PubMed:17105200, PubMed:26289831). Interacts with MAPK1 (By similarity). Interacts with GAPDH; the interaction is direct (By similarity). Interacts with LIMK1 (via the PDZ domain); the interaction is direct (PubMed:18028908, PubMed:22328514). Interacts with LIMK2 (PubMed:22328514). Interacts with HDAC6; thereby inhibiting the tubulin deacetylase activity of HDAC6 (PubMed:20308065, PubMed:23093407). Interacts with aggregated SNCA; may have a pro-aggregatory role in synucleinopathies (PubMed:15590652, PubMed:17027006). Interacts with DYNLL1 (PubMed:31505170).

Similarity:

Most of the protein is composed of disordered regions (PubMed:21316364). Zinc-binding induces structural rearrangement by promoting molten globule state formation (PubMed:21995432).

Belongs to the TPPP family.

WB Images(1)


ELISA analysis of AF8329 showing specificity to Phospho-TPPP (Ser18) Blocking Peptide peptide. Peptides concentration: 1ug/ml.
P-peptide: phospho-peptide; N-peptide: non-phospho-peptide.
No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF8329-BP
(Blocking peptide available as AF8329-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Dog
100%
Bovine
89%
Chicken
75%
Rabbit
0%
Zebrafish
0%
Xenopus
0%
Sheep
0%
Horse
0%
High similarity Medium similarity Low similarity No similarity
O94811 as Substrate
Site PTM Type Enzyme
T14 Phosphorylation Q00535 (CDK5) , P28482 (MAPK1)
S18 Phosphorylation P28482 (MAPK1) , Q00535 (CDK5)
S23 Phosphorylation
K24 Acetylation
S32 Phosphorylation P17612 (PRKACA)
S35 Phosphorylation
S45 Phosphorylation
S49 Phosphorylation
K78 Methylation
T92 Phosphorylation P17612 (PRKACA)
S107 Phosphorylation
S152 O-Glycosylation
T155 O-Glycosylation
S159 Phosphorylation P17612 (PRKACA)
S160 Phosphorylation P28482 (MAPK1) , Q00535 (CDK5)
T162 Phosphorylation
K185 Acetylation
K187 Acetylation
K189 Acetylation
Y201 Phosphorylation
S203 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top