HEN2 Antibody - #DF10046
Product: | HEN2 Antibody |
Catalog: | DF10046 |
Description: | Rabbit polyclonal antibody to HEN2 |
Application: | WB IHC |
Reactivity: | Human, Mouse |
Prediction: | Pig, Bovine, Rabbit, Dog |
Mol.Wt.: | 15 kDa; 15kD(Calculated). |
Uniprot: | Q02577 |
RRID: | AB_2840626 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10046, RRID:AB_2840626.
Fold/Unfold
bHLHa34; Class A basic helix-loop-helix protein 34; Helix-loop-helix protein 2; HEN-2; HEN2; HEN2_HUMAN; KIAA0490; Nescient helix loop helix 2; Nhlh2; NSCL-2; NSCL2;
Immunogens
- Q02577 HEN2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q02577 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
T106 | Phosphorylation | Uniprot |
Research Backgrounds
May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.
Nucleus.
Efficient DNA binding requires dimerization with another bHLH protein.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.