KLRC2/4 Antibody - #DF10154
| Product: | KLRC2/4 Antibody |
| Catalog: | DF10154 |
| Description: | Rabbit polyclonal antibody to KLRC2/4 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat |
| Mol.Wt.: | 18 kDa; 26kD,18kD(Calculated). |
| Uniprot: | P26717 | O43908 |
| RRID: | AB_2840733 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF10154, RRID:AB_2840733.
Fold/Unfold
CD antigen CD159c; CD159 antigen like family member C; CD159 antigen-like family member C; CD159c; Killer cell lectin like receptor subfamily C, member 2; KLRC2; NK cell receptor C; NKG2-C type II integral membrane protein; NKG2-C-activating NK receptor; NKG2C activating NK receptor; NKG2C; NKG2C_HUMAN; killer cell lectin-like receptor subfamily C, member 4; KLRC4; NK cell receptor F; NKG2 F; NKG2-F type II integral membrane protein; NKG2-F-activating NK receptor; NKG2F; NKG2F_HUMAN;
Immunogens
- P26717 NKG2C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSKQRGTFSEVSLAQDPKRQQRKPKGNKSSISGTEQEIFQVELNLQNPSLNHQGIDKIYDCQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
- O43908 NKG2F_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGNDKTYHCKGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPCIGVLEQNNFSLNRRMQKARHCGHCPEEWITYSNSCYYIGKERRTWEERVCWPVLRRTLICFL
PTMs - P26717/O43908 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S32 | Phosphorylation | Uniprot |
Research Backgrounds
Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
Membrane>Single-pass type II membrane protein.
Natural killer cells.
Can form disulfide-bonded heterodimer with KLRD1. Interacts with TYROBP. KLRD1-KLRC2 receptor complex can bind with low affinity to peptide-bound HLA-E-B2M complex.
May play a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells.
Membrane>Single-pass type II membrane protein.
Natural killer cells.
Can form disulfide-bonded heterodimer with CD94.
Research Fields
· Organismal Systems > Immune system > Antigen processing and presentation. (View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity. (View pathway)
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.