UGT2B Antibody - #DF7734
| Product: | UGT2B Antibody |
| Catalog: | DF7734 |
| Description: | Rabbit polyclonal antibody to UGT2B |
| Application: | WB IHC |
| Reactivity: | Human, Mouse |
| Mol.Wt.: | 61 kDa; 61kD(Calculated). |
| Uniprot: | O75795 |
| RRID: | AB_2841202 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF7734, RRID:AB_2841202.
Fold/Unfold
C19 steroid specific UDP glucuronosyltransferase; C19 steroid specific UDPGT; UDB17; UDP glucuronosyltransferase 2B17; UDPGT 2B17;
Immunogens
Expressed in various tissues including the liver, kidney, testis, uterus, placenta, mammary gland, adrenal gland, skin and prostate.
- O75795 UDB17_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSLKWMSVFLLMQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD
PTMs - O75795 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K410 | Acetylation | Uniprot |
Research Backgrounds
UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. The major substrates of this isozyme are eugenol > 4-methylumbelliferone > dihydrotestosterone (DHT) > androstane-3-alpha,17-beta-diol (3-alpha-diol) > testosterone > androsterone (ADT).
Microsome membrane>Single-pass membrane protein. Endoplasmic reticulum membrane>Single-pass membrane protein.
Expressed in various tissues including the liver, kidney, testis, uterus, placenta, mammary gland, adrenal gland, skin and prostate.
Belongs to the UDP-glycosyltransferase family.
Research Fields
· Human Diseases > Cancers: Overview > Chemical carcinogenesis.
· Metabolism > Carbohydrate metabolism > Pentose and glucuronate interconversions.
· Metabolism > Carbohydrate metabolism > Ascorbate and aldarate metabolism.
· Metabolism > Lipid metabolism > Steroid hormone biosynthesis.
· Metabolism > Metabolism of cofactors and vitamins > Retinol metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Porphyrin and chlorophyll metabolism.
· Metabolism > Xenobiotics biodegradation and metabolism > Metabolism of xenobiotics by cytochrome P450.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - cytochrome P450.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.