Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    SOX11 Antibody
  • Catalog No.
    DF8614
  • RRID
    AB_2841818
  • Source
    Rabbit
  • Application
    WB,IF/ICC,ELISA
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%), Xenopus(92%)
  • UniProt
  • Mol.Wt
    46kD,55kD;
    47kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

MRD27; SOX11; SOX11_HUMAN; SRY (sex determining region Y) box 11; SRY related HMG box gene 11; SRY-box 11; Transcription factor SOX-11;

Applications:

WB 1:1000-3000, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%), Xenopus(92%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

SOX11 Antibody detects endogenous levels of total SOX11.

RRID:

AB_2841818
Please cite this product as: Affinity Biosciences Cat# DF8614, RRID:AB_2841818.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human SOX11, corresponding to a region within C-terminal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

SOX11

Molecular Weight:

Observed Mol.Wt.: 46kD,55kD.
Predicted Mol.Wt.: 47kDa(Calculated)..

Subcellular Location:

Nucleus.

Tissue Specificity:

P35716 SOX11_HUMAN:
Expressed mainly in the nervous system, brain (fetus and adult) and hear (adult).

Sequence:
MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSSSSSGSSSGSSGEDADDLMFDLSLNFSQSAHSASEQQLGGGAAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWLEANFSDLVFTY

Research Background

Function:

Transcriptional factor involved in the embryonic neurogenesis. May also have a role in tissue modeling during development.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Expressed mainly in the nervous system, brain (fetus and adult) and hear (adult).

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF8614-BP
(Blocking peptide available as DF8614-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Horse
100%
Sheep
100%
Chicken
100%
Rabbit
100%
Xenopus
92%
Bovine
0%
Dog
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
P35716 as Substrate
Site PTM Type Enzyme
S30 Phosphorylation
S60 Phosphorylation
S71 Phosphorylation
K81 Ubiquitination
K108 Ubiquitination
K117 Ubiquitination
S129 Phosphorylation
S137 Phosphorylation
K158 Acetylation
T159 Phosphorylation
S163 Phosphorylation
S206 Phosphorylation
S278 Phosphorylation
S332 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top