MRD27; SOX11; SOX11_HUMAN; SRY (sex determining region Y) box 11; SRY related HMG box gene 11; SRY-box 11; Transcription factor SOX-11;
WB 1:1000-3000, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Human, Mouse, Rat
Pig(100%), Horse(100%), Sheep(100%), Rabbit(100%), Chicken(100%), Xenopus(92%)
Rabbit
Polyclonal
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
SOX11 Antibody detects endogenous levels of total SOX11.
AB_2841818
Please cite this product as: Affinity Biosciences Cat# DF8614, RRID:AB_2841818.
Liquid
1mg/ml
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.
A synthesized peptide derived from human SOX11, corresponding to a region within C-terminal amino acids.
>>Visit The Human Protein Atlas
SOX11
Observed Mol.Wt.: 46kD,55kD.
Predicted Mol.Wt.: 47kDa(Calculated)..
Nucleus.
P35716 SOX11_HUMAN:
Expressed mainly in the nervous system, brain (fetus and adult) and hear (adult).
MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSSSSSGSSSGSSGEDADDLMFDLSLNFSQSAHSASEQQLGGGAAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWLEANFSDLVFTY
Transcriptional factor involved in the embryonic neurogenesis. May also have a role in tissue modeling during development.
Nucleus.
Expressed mainly in the nervous system, brain (fetus and adult) and hear (adult).
DF8614-BP
(Blocking peptide available as DF8614-BP)
$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).
Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.
Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S30 | Phosphorylation | Uniprot | |
S60 | Phosphorylation | Uniprot | |
S71 | Phosphorylation | Uniprot | |
K81 | Ubiquitination | Uniprot | |
K108 | Ubiquitination | Uniprot | |
K117 | Ubiquitination | Uniprot | |
S129 | Phosphorylation | Uniprot | |
S137 | Phosphorylation | Uniprot | |
K158 | Acetylation | Uniprot | |
T159 | Phosphorylation | Uniprot | |
S163 | Phosphorylation | Uniprot | |
S206 | Phosphorylation | Uniprot | |
S278 | Phosphorylation | Uniprot | |
S332 | Phosphorylation | Uniprot |