Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    VAMP 1/2/3 Antibody
  • Catalog No.
    DF8628
  • RRID
    AB_2841832
  • Source
    Rabbit
  • Application
    WB,IHC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • UniProt
  • Mol.Wt
    12 kD;
    13kDa,11kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

CEB; cellubrevin; SYB1; SYB2; synaptobrevin 1; synaptobrevin 2; synaptobrevin 3; synaptobrevin1; synaptobrevin2; synaptobrevin3; VAMP 1; VAMP3; Vesicle associated membrane protein 1; Vesicle associated membrane protein 2; Vesicle associated membrane protein 3; FLJ11460; RATVAMPB; RATVAMPIR; SYB; SYB2; Synaptobrevin 2; Synaptobrevin-2; VAMP 2; VAMP-2; Vamp2; VAMP2_HUMAN; Vesicle associated membrane protein 2; Vesicle-associated membrane protein 2 (synaptobrevin 2); Vesicle-associated membrane protein 2; CEB; Cellubrevin; Synaptobrevin 3; Synaptobrevin-3; VAMP 3; VAMP-3; VAMP3; VAMP3_HUMAN; Vesicle associated membrane protein 3; Vesicle-associated membrane protein 3;

Applications:

WB 1:1000-3000, IHC 1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

VAMP 1/2/3 Antibody detects endogenous levels of total VAMP 1/2/3.

RRID:

AB_2841832
Please cite this product as: Affinity Biosciences Cat# DF8628, RRID:AB_2841832.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human VAMP 1/2/3, corresponding to a region within C-terminal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

VAMP1,VAMP3,VAMP2

Molecular Weight:

Observed Mol.Wt.: 12 kD.
Predicted Mol.Wt.: 13kDa,11kDa(Calculated)..

Subcellular Location:

Cytoplasmic vesicle. Membrane.

Tissue Specificity:

P23763 VAMP1_HUMAN:
Nervous system, skeletal muscle and adipose tissue.

P63027 VAMP2_HUMAN:
Nervous system and skeletal muscle.

Sequence:
MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT

MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGITVLVIFIIIIIVWVVSS

Research Background

Function:

Involved in the targeting and/or fusion of transport vesicles to their target membrane.

Post-translational Modifications:

(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type B (BoNT/B, botB) which probably hydrolyzes the 78-Gln-|-Phe-79 bond and inhibits neurotransmitter release.

(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type D (BoNT/D, botD) which probably hydrolyzes the 61-Arg-|-Leu-62 bond and inhibits neurotransmitter release. BoNT/D has low catalytic activity on this protein due to its sequence. Note that humans are not known to be infected by C.botulinum type D.

(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type F (BoNT/F, botF) which probably hydrolyzes the 60-Gln-|-Lys-61 bond and inhibits neurotransmitter release.

(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type X (BoNT/X) which probably hydrolyzes the 68-Arg-|-Ala-69 bond and inhibits neurotransmitter release. It remains unknown whether BoNT/X is ever produced, or what organisms it targets.

Subcellular Location:

Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass type IV membrane protein. Cell junction>Synapse>Synaptosome.

Cytoplasmic vesicle membrane>Single-pass type IV membrane protein. Cell junction>Synapse>Synaptosome.

Mitochondrion outer membrane>Single-pass type IV membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Nervous system, skeletal muscle and adipose tissue.

Subunit Structure:

Interacts with VAPA and VAPB.

Similarity:

Belongs to the synaptobrevin family.

Function:

Involved in the targeting and/or fusion of transport vesicles to their target membrane. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1.

Post-translational Modifications:

Phosphorylated by PRKCZ in vitro and this phosphorylation is increased in the presence of WDFY2.

(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type B (BoNT/B, botB) which hydrolyzes the 76-Gln-|-Phe-77 bond and probably inhibits neurotransmitter release.

(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type D (BoNT/D, botD) which probably hydrolyzes the 59-Lys-|-Leu-60 bond and inhibits neurotransmitter release. Note that humans are not known to be infected by C.botulinum type D.

(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type F (BoNT/F, botF) which hydrolyzes the 58-Gln-|-Lys-59 bond and probably inhibits neurotransmitter release.

(Microbial infection) Targeted and hydrolyzed by C.tetani tetanus toxin (tetX) which hydrolyzes the 76-Gln-|-Phe-77 bond and probably inhibits neurotransmitter release.

Subcellular Location:

Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass type IV membrane protein. Cell junction>Synapse>Synaptosome. Cell membrane.
Note: Neuronal synaptic vesicles. Colocalizes with PRKCZ and WDFY2 in intracellular vesicles (PubMed:17313651).

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Nervous system and skeletal muscle.

Subunit Structure:

Interacts (via N-terminus) with KCNB1 (via N-terminus and C-terminus); stimulates the channel inactivation rate of KCNB1 (By similarity). Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Interacts with BVES and STX4 (By similarity). Interacts with VAPA and VAPB. Interacts with WDFY2, PRKCZ and PRKCI. Forms a complex with WDFY2 and PRKCZ. Interacts with SEPT8; the interaction inhibits interaction of VAMP2 with SYP. Interacts with SYP; the interaction is inhibited by interaction with SEPT8 (By similarity). Interacts with PICALM. Interacts with alpha-synuclein/SNCA. Interacts with STX3 (By similarity).

Similarity:

Belongs to the synaptobrevin family.

Function:

SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.

Post-translational Modifications:

(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type B (BoNT/B, botB) which hydrolyzes the 59-Gln-|-Phe-60 bond and probably inhibits neurotransmitter release.

(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type D (BoNT/D, botD) which hydrolyzes the 42-Lys-|-Leu-43 bond and probably inhibits neurotransmitter release. Note that humans are not known to be infected by C.botulinum type D.

(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type F (BoNT/F, botF) which hydrolyzes the 41-Gln-|-Lys-42 bond and probably inhibits neurotransmitter release.

Subcellular Location:

Membrane>Single-pass type IV membrane protein. Cell junction>Synapse>Synaptosome.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Interacts with BVES (via the C-terminus cytoplasmic tail). Interacts with BCAP31; involved in VAMP3 export from the endoplasmic reticulum (By similarity). Interacts with BAIAP3; this interaction is increased in the presence of calcium. Interacts with PICALM.

Similarity:

Belongs to the synaptobrevin family.

Research Fields

Research Fields:

· Genetic Information Processing > Folding, sorting and degradation > SNARE interactions in vesicular transport.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF8628-BP
(Blocking peptide available as DF8628-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

P23763/P63027/Q15836 as Substrate
Site PTM Type Enzyme
K52 Ubiquitination
K59 Ubiquitination
S61 Phosphorylation
R66 Methylation
S75 Phosphorylation
T79 Phosphorylation
S80 Phosphorylation
K83 Ubiquitination
K85 Ubiquitination
K91 Ubiquitination
Site PTM Type Enzyme
S2 Phosphorylation
K54 Ubiquitination
K61 Ubiquitination
S63 Phosphorylation
K85 Ubiquitination
Site PTM Type Enzyme
S2 Acetylation
S2 Phosphorylation
T3 Phosphorylation
T9 Phosphorylation
S11 Phosphorylation
T18 Phosphorylation
K35 Ubiquitination
K42 Ubiquitination
S44 Phosphorylation
R49 Methylation
S58 Phosphorylation
T62 Phosphorylation
S63 Phosphorylation
K66 Ubiquitination
K68 Ubiquitination
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top