DUSP14 Antibody - #DF8767
| Product: | DUSP14 Antibody |
| Catalog: | DF8767 |
| Description: | Rabbit polyclonal antibody to DUSP14 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | O95147 |
| RRID: | AB_2841971 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF8767, RRID:AB_2841971.
Fold/Unfold
Dual specificity phosphatase 14; Dual specificity protein phosphatase 14; DUS14_HUMAN; DUSP 14; DUSP14; DUSP14 protein; MAP kinase phosphatase 6; Mitogen activated protein kinase phosphatase 6; Mitogen-activated protein kinase phosphatase 6; MKP 1 like protein tyrosine phosphatase; MKP 6; MKP L; MKP-1-like protein tyrosine phosphatase; MKP-6; MKP-L; MKP1 like protein tyrosine phosphatase; MKP6; MKPL;
Immunogens
- O95147 DUS14_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - O95147 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| R4 | Methylation | Uniprot | |
| S7 | Phosphorylation | Uniprot | |
| T8 | Phosphorylation | Uniprot | |
| R11 | Methylation | Uniprot | |
| R17 | Methylation | Uniprot | |
| K96 | Ubiquitination | Uniprot | |
| S99 | Phosphorylation | Uniprot | |
| S101 | Phosphorylation | Uniprot | |
| K103 | Ubiquitination | Uniprot | |
| Y161 | Phosphorylation | Uniprot | |
| K168 | Ubiquitination | Uniprot | |
| S169 | Phosphorylation | Uniprot | |
| K172 | Ubiquitination | Uniprot | |
| T176 | Phosphorylation | Uniprot | |
| Y178 | Phosphorylation | Uniprot | |
| K187 | Ubiquitination | Uniprot |
Research Backgrounds
Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases.
Interacts with CD28.
Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.