ANXA11 Antibody - #DF9215
Product: | ANXA11 Antibody |
Catalog: | DF9215 |
Description: | Rabbit polyclonal antibody to ANXA11 |
Application: | WB |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 54kDa; 54kD(Calculated). |
Uniprot: | P50995 |
RRID: | AB_2842411 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF9215, RRID:AB_2842411.
Fold/Unfold
56 kDa autoantigen; Annexin A11; Annexin XI; Annexin-11; AnnexinA11; AnnexinXI; ANX 11; ANX A11; ANX11; ANX11_HUMAN; ANXA 11; ANXA11; Autoantigen 56 kD; Calcyclin associated annexin 50; Calcyclin-associated annexin 50; CAP 50; CAP-50; CAP50; OTTHUMP00000059806;
Immunogens
- P50995 ANX11_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P50995 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y53 | Phosphorylation | Uniprot | |
K214 | Ubiquitination | Uniprot | |
K248 | Acetylation | Uniprot | |
K248 | Ubiquitination | Uniprot | |
K252 | Ubiquitination | Uniprot | |
K255 | Acetylation | Uniprot | |
K255 | Sumoylation | Uniprot | |
K255 | Ubiquitination | Uniprot | |
S259 | Phosphorylation | Uniprot | |
K264 | Methylation | Uniprot | |
K264 | Ubiquitination | Uniprot | |
K271 | Ubiquitination | Uniprot | |
T272 | Phosphorylation | Uniprot | |
Y279 | Phosphorylation | Uniprot | |
K282 | Acetylation | Uniprot | |
K282 | Sumoylation | Uniprot | |
K282 | Ubiquitination | Uniprot | |
K286 | Ubiquitination | Uniprot | |
T290 | Phosphorylation | Uniprot | |
C294 | S-Nitrosylation | Uniprot | |
S301 | Phosphorylation | Uniprot | |
K315 | Ubiquitination | Uniprot | |
K320 | Ubiquitination | Uniprot | |
T321 | Phosphorylation | Uniprot | |
R346 | Methylation | Uniprot | |
Y365 | Phosphorylation | Uniprot | |
K378 | Sumoylation | Uniprot | |
K378 | Ubiquitination | Uniprot | |
C384 | S-Nitrosylation | Uniprot | |
R400 | Methylation | Uniprot | |
K408 | Acetylation | Uniprot | |
K408 | Ubiquitination | Uniprot | |
S415 | Phosphorylation | Uniprot | |
K427 | Ubiquitination | Uniprot | |
C428 | S-Nitrosylation | Uniprot | |
K430 | Ubiquitination | Uniprot | |
R439 | Methylation | Uniprot | |
T464 | Phosphorylation | Uniprot | |
R470 | Methylation | Uniprot | |
K479 | Acetylation | Uniprot | |
K479 | Ubiquitination | Uniprot | |
S480 | Phosphorylation | Uniprot | |
Y482 | Phosphorylation | Uniprot | |
S486 | Phosphorylation | Uniprot | |
T489 | Phosphorylation | Uniprot | |
S490 | Phosphorylation | Uniprot | |
Y493 | Phosphorylation | Uniprot | |
K499 | Sumoylation | Uniprot | |
K499 | Ubiquitination | Uniprot |
Research Backgrounds
Binds specifically to calcyclin in a calcium-dependent manner (By similarity). Required for midbody formation and completion of the terminal phase of cytokinesis.
Cytoplasm. Melanosome. Nucleus envelope. Nucleus>Nucleoplasm. Cytoplasm>Cytoskeleton>Spindle.
Note: Found throughout the nucleoplasm at interphase and during mitosis concentrates around the mitotic apparatus (By similarity). Elevation of intracellular calcium causes relocalization from the nucleoplasm to the nuclear envelope, with little effect on the cytoplasmic pool. Localization to the nuclear envelope is cell-cycle dependent.
Interacts with S100A6. Interacts with PDCD6 in a calcium-dependent manner. Interacts with KIF23 during cytokinesis.
A pair of annexin repeats may form one binding site for calcium and phospholipid.
Belongs to the annexin family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.