ARP-1 Antibody - #AF9015
| Product: | ARP-1 Antibody |
| Catalog: | AF9015 |
| Description: | Rabbit polyclonal antibody to ARP-1 |
| Application: | WB IF/ICC |
| Reactivity: | Human |
| Prediction: | Bovine, Dog |
| Mol.Wt.: | 45kDa; 46kD(Calculated). |
| Uniprot: | P24468 |
| RRID: | AB_2843206 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9015, RRID:AB_2843206.
Fold/Unfold
Apolipoprotein A-I regulatory protein 1; Apolipoprotein AI regulatory protein 1; ARP-1; ARP1; COT2_HUMAN; COUP TF2; COUP transcription factor 2; COUP transcription factor II; COUP-TF II; COUP-TF2; NR2F2; Nuclear receptor subfamily 2 group F member 2;
Immunogens
- P24468 COT2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P24468 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| T39 | Phosphorylation | Uniprot | |
| T51 | Phosphorylation | Uniprot | |
| K89 | Ubiquitination | Uniprot | |
| S112 | Phosphorylation | Uniprot | |
| K141 | Methylation | Uniprot | |
| K301 | Ubiquitination | Uniprot | |
| Y348 | Phosphorylation | Uniprot | |
| K362 | Ubiquitination | Uniprot | |
| K389 | Ubiquitination | Uniprot | |
| T394 | Phosphorylation | Uniprot |
Research Backgrounds
Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A.
Nucleus.
Ubiquitous.
Interacts with SQSTM1 (By similarity). Binds DNA as a dimer; homodimer or heterodimer with NR2F6. Interacts with NCOA1, NCOA2, NCOA3 and PPARGC1A. Interacts with ZFPM2 (By similarity).
Belongs to the nuclear hormone receptor family. NR2 subfamily.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.