HoxD8 Antibody - #AF9090
Product: | HoxD8 Antibody |
Catalog: | AF9090 |
Description: | Rabbit polyclonal antibody to HoxD8 |
Application: | WB IF/ICC |
Reactivity: | Human |
Mol.Wt.: | 32kDa; 32kD(Calculated). |
Uniprot: | P13378 |
RRID: | AB_2843281 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF9090, RRID:AB_2843281.
Fold/Unfold
homeo box 4E; homeo box D8; Homeobox 4E; homeobox D8; homeobox protein 5.4; Homeobox protein Hox-4E; Homeobox protein Hox-5.4; Homeobox protein Hox-D8; Hox-4.5; Hox-4.5, mouse, homolog of; Hox-4E; Hox-5.4; HOX4; HOX4E; Hoxd8; HXD8_HUMAN;
Immunogens
- P13378 HXD8_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSYFVNPLYSKYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAALQLYGNSAAGFPHAPPQAHAHPHPSPPPSGTGCGGREGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPPPCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFPWMRPQAAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN
PTMs - P13378 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Y10 | Phosphorylation | Uniprot | |
S11 | Phosphorylation | Uniprot | |
Y13 | Phosphorylation | Uniprot |
Research Backgrounds
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Nucleus.
Belongs to the Antp homeobox family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.