Price Size
$350 100ul
$450 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    Phospho-SGK3 (Ser486) Antibody
  • Catalog No.
    AF7430
  • RRID
    AB_2843870
  • Source
    Rabbit
  • Application
    WB,IHC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
  • UniProt
  • Mol.Wt
    57kD;
    57kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

CISK; Cytokine independent survival kinase; DKFZp781N0293; Serine/threonine protein kinase Sgk3; Serine/threonine-protein kinase Sgk3; Serum/glucocorticoid regulated kinase 3; Serum/glucocorticoid regulated kinase family member 3; Serum/glucocorticoid regulated kinase like; Serum/glucocorticoid-regulated kinase 3; Serum/glucocorticoid-regulated kinase-like; SGK 2; SGK 3; SGK2; Sgk3; SGK3_HUMAN; SGKL;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig, Zebrafish, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Specificity:

Phospho-SGK3 (Ser486) Antibody detects endogenous levels of SGK3 only when phosphorylated at Ser486.

RRID:

AB_2843870
Please cite this product as: Affinity Biosciences Cat# AF7430, RRID:AB_2843870.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human SGK3 around the phosphorylation site of Ser486.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

SGK3

Molecular Weight:

Observed Mol.Wt.: 57kD.
Predicted Mol.Wt.: 57kDa(Calculated)..

Subcellular Location:

Cytoplasmic vesicle. Early endosome. Localized in vesicle-like structures and in the early endosome.

Tissue Specificity:

Q96BR1 SGK3_HUMAN:
Expressed in most tissues with highest levels in pancreas, kidney liver, heart and brain and lower levels in lung, placenta and skeletal muscle. Expression is higher in ER-positive breast tumors than ER-negative breast tumors.

Sequence:
MQRDHTMDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSEDLFL

Research Background

Function:

Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, proliferation, survival and migration. Up-regulates Na(+) channels: SCNN1A/ENAC and SCN5A, K(+) channels: KCNA3/KV1.3, KCNE1, KCNQ1 and KCNH2/HERG, epithelial Ca(2+) channels: TRPV5 and TRPV6, chloride channel: BSND, creatine transporter: SLC6A8, Na(+)/dicarboxylate cotransporter: SLC13A2/NADC1, Na(+)-dependent phosphate cotransporter: SLC34A2/NAPI-2B, amino acid transporters: SLC1A5/ASCT2 and SLC6A19, glutamate transporters: SLC1A3/EAAT1, SLC1A6/EAAT4 and SLC1A7/EAAT5, glutamate receptors: GRIA1/GLUR1 and GRIK2/GLUR6, Na(+)/H(+) exchanger: SLC9A3/NHE3, and the Na(+)/K(+) ATPase. Plays a role in the regulation of renal tubular phosphate transport and bone density. Phosphorylates NEDD4L and GSK3B. Positively regulates ER transcription activity through phosphorylation of FLII. Negatively regulates the function of ITCH/AIP4 via its phosphorylation and thereby prevents CXCR4 from being efficiently sorted to lysosomes.

Post-translational Modifications:

Activated by phosphorylation on Ser-486 by an unknown kinase (may be mTORC2 but not confirmed), transforming it into a substrate for PDPK1 which then phosphorylates it on Thr-320.

Subcellular Location:

Cytoplasmic vesicle. Early endosome. Recycling endosome.
Note: Endosomal localization is a prerequisite for complete kinase activity. It is essential for its colocalization with the kinase responsible for phosphorylating Ser-486 thus allowing PDPK1 phosphorylation of Thr-320 resulting in complete activation of SGK3. Localized in vesicle-like structures and in the early endosome. Colocalizes with SLC9A3/NHE3 in the recycling endosomes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Expressed in most tissues with highest levels in pancreas, kidney liver, heart and brain and lower levels in lung, placenta and skeletal muscle. Expression is higher in ER-positive breast tumors than ER-negative breast tumors.

Subunit Structure:

Interacts with GSK3B and FLII. Interacts with PDPK1 in a phosphorylation-dependent manner.

Similarity:

Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.

Research Fields

Research Fields:

· Environmental Information Processing > Signal transduction > FoxO signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > PI3K-Akt signaling pathway.(View pathway)

WB Images(1)


IHC Images(1)


ELISA analysis of AF7430 showing specificity to Phospho-SGK3 (Ser486) Blocking Peptide peptide. Peptides concentration: 1ug/ml.
P-peptide: phospho-peptide; N-peptide: non-phospho-peptide.
No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF7430-BP
(Blocking peptide available as AF7430-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Bovine
100%
Sheep
100%
Dog
100%
Chicken
100%
Rabbit
100%
Horse
92%
Xenopus
92%
Zebrafish
92%
High similarity Medium similarity Low similarity No similarity
Q96BR1 as Substrate
Site PTM Type Enzyme
T32 Phosphorylation
K75 Methylation
S121 Phosphorylation
S126 Phosphorylation
S129 Phosphorylation
K139 Ubiquitination
K158 Ubiquitination
K166 Ubiquitination
Y188 Phosphorylation
K191 Ubiquitination
K216 Ubiquitination
S315 Phosphorylation
T318 Phosphorylation
T320 Phosphorylation O15530 (PDPK1)
T324 Phosphorylation
K407 Ubiquitination
S486 Phosphorylation
Q96BR1 as PTM Enzyme
Substrate Site Source
O43524 (FOXO3) S253 Uniprot
P49840 (GSK3A) S21 Uniprot
P49841 (GSK3B) S9 Uniprot
P49841-2 (GSK3B) S21 Uniprot
Q13045 (FLII) S436 Uniprot
Q13045 (FLII) T818 Uniprot
Q96J02 (ITCH) T385 Uniprot
Q96J02 (ITCH) S450 Uniprot
Q96PU5 (NEDD4L) S448 Uniprot
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top