Price Size
$250 50ul
$350 100ul
$450 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    SMYD2 Antibody
  • Catalog No.
    AF7591
  • RRID
    AB_2843955
  • Source
    Rabbit
  • Application
    WB,ELISA(peptide)
  • Reactivity
    Human, Mouse
  • Prediction
    Pig, Bovine, Horse, Rabbit, Dog, Chicken
  • UniProt
  • Mol.Wt
    49kD;
    50kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Histone methyltransferase SMYD2; HSKM B; HSKM-B; HSKMB; KMT3C; Lysine N-methyltransferase 3C; MGC119305; N lysine methyltransferase SMYD2; N-lysine methyltransferase SMYD2; SET and MYND domain containing 2; SET and MYND domain containing protein 2; SET and MYND domain-containing protein 2; Smyd2; SMYD2_HUMAN; Zinc finger MYND domain containing 14; ZMYND14;

Applications:

WB 1:500-1:2000, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse

Predicted Reactivity:

Pig, Bovine, Horse, Rabbit, Dog, Chicken

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

SMYD2 Antibody detects endogenous levels of total SMYD2.

RRID:

AB_2843955
Please cite this product as: Affinity Biosciences Cat# AF7591, RRID:AB_2843955.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human SMYD2, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

SMYD2

Molecular Weight:

Observed Mol.Wt.: 49kD.
Predicted Mol.Wt.: 50kDa(Calculated)..

Subcellular Location:

Cytoplasm > cytosol. Nucleus.

Sequence:
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH

Research Background

Function:

Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins, including p53/TP53 and RB1. Specifically trimethylates histone H3 'Lys-4' (H3K4me3) in vivo. The activity requires interaction with HSP90alpha. Shows even higher methyltransferase activity on p53/TP53. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates RB1 at 'Lys-860'.

Subcellular Location:

Cytoplasm>Cytosol. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Interacts with RNA polymerase II and HELZ. Interacts with SIN3A and HDAC1 (By similarity). Interacts (via MYND-type zinc finger) with EPB41L3. Interacts (via SET domain) with p53/TP53. Interacts with RB1 and HSP90AA1.

Similarity:

Belongs to the class V-like SAM-binding methyltransferase superfamily.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF7591-BP
(Blocking peptide available as AF7591-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Dog
100%
Pig
90%
Horse
90%
Bovine
90%
Rabbit
90%
Chicken
80%
Sheep
0%
Xenopus
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
Q9NRG4 as Substrate
Site PTM Type Enzyme
S35 Phosphorylation
T44 Phosphorylation
K80 Ubiquitination
K127 Ubiquitination
K132 Ubiquitination
K145 Ubiquitination
K146 Ubiquitination
S283 Phosphorylation
K312 Ubiquitination
K398 Methylation
K418 Ubiquitination
K427 Ubiquitination
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top