IFT20 Antibody - #DF12014
| Product: | IFT20 Antibody |
| Catalog: | DF12014 |
| Description: | Rabbit polyclonal antibody to IFT20 |
| Application: | WB IHC |
| Reactivity: | Human, Mouse, Rat, Dog, Monkey |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 15-18 kDa; 15kD(Calculated). |
| Uniprot: | Q8IY31 |
| RRID: | AB_2844819 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12014, RRID:AB_2844819.
Fold/Unfold
hIFT20; Intraflagellar transport 20 homolog (Chlamydomonas); Intraflagellar transport protein 20 like; Intraflagellar transport protein IFT20;
Immunogens
- Q8IY31 IFT20_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAEQNEFIDQFIFQK
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q8IY31 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| K18 | Ubiquitination | Uniprot | |
| T27 | Phosphorylation | Uniprot | |
| T30 | Phosphorylation | Uniprot | |
| K34 | Ubiquitination | Uniprot | |
| K100 | Ubiquitination | Uniprot |
Research Backgrounds
Part of intraflagellar transport (IFT) particles involved in ciliary process assembly. May play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium. Regulates the platelet-derived growth factor receptor-alpha (PDGFRA) signaling pathway. Required for protein stability of E3 ubiquitin ligases CBL and CBLB that mediate ubiquitination and internalization of PDGFRA for proper feedback inhibition of PDGFRA signaling. Essential for male fertility. Plays an important role in spermatogenesis, particularly spermiogenesis, when germ cells form flagella. May play a role in the transport of flagellar proteins ODF2 and SPAG16 to build sperm flagella and in the removal of redundant sperm cytoplasm (By similarity). Also involved in autophagy since it is required for trafficking of ATG16L and the expansion of the autophagic compartment (By similarity).
Golgi apparatus>cis-Golgi network. Cytoplasm>Cytoskeleton>Microtubule organizing center>Centrosome>Centriole. Cytoplasm>Cytoskeleton>Cilium basal body. Cell projection>Cilium. Cytoplasm>Cytoskeleton. Golgi apparatus.
Note: Present at the centrosomes during the cell cycle and associated with the proximal portion of the mother centriole and the lateral aspect of the daughter centriole. Associated with basal body at the base of primary cilia. Detected in the Golgi apparatus of round spermatids and late spermatocytes. Also detected in the manchette of step 10-12 spermatids. In step 14 spermatids, found in the basal body of the sperm tail.
Expressed in almost all tissues.
Component of the IFT complex B, at least composed of IFT20, IFT22, HSPB11/IFT25, IFT27, IFT46, IFT52, TRAF3IP1/IFT54, IFT57, IFT74, IFT80, IFT81, and IFT88. Interacts directly with IFT57 and KIF3B/Kinesin II subunit (By similarity). Interacts with IFT88 (By similarity). Interacts with CEP83. Interacts with SPEF2 (via C-terminus). Interacts with CBL and CBLB. Interacts with TRIP11. Interacts with TTC21A.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.