S100A14 Antibody - #DF12042
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12042, RRID:AB_2844847.
Fold/Unfold
BCMP84; Protein S100-A14; S100 calcium binding protein A14; S100 calcium-binding protein A14; S100a14; S100A15; S10AE_HUMAN; S114;
Immunogens
Expressed at highest levels in colon and at moderate levels in thymus, kidney, liver, small intestine, and lung. Low expression in heart and no expression is seen in brain, skeletal muscle, spleen, placenta and peripheral blood leukocytes.
- Q9HCY8 S10AE_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9HCY8 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S6 | Phosphorylation | Uniprot | |
| S16 | Phosphorylation | Uniprot | |
| K27 | Acetylation | Uniprot | |
| K27 | Ubiquitination | Uniprot | |
| Y32 | Phosphorylation | Uniprot | |
| S33 | Phosphorylation | Uniprot | |
| K38 | Ubiquitination | Uniprot | |
| T40 | Phosphorylation | Uniprot | |
| T42 | Phosphorylation | Uniprot | |
| S73 | Phosphorylation | Uniprot | |
| S83 | Phosphorylation | Uniprot | |
| K93 | Ubiquitination | Uniprot |
Research Backgrounds
Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.
Cytoplasm.
Expressed at highest levels in colon and at moderate levels in thymus, kidney, liver, small intestine, and lung. Low expression in heart and no expression is seen in brain, skeletal muscle, spleen, placenta and peripheral blood leukocytes.
Homodimer. Interacts with AGER.
Belongs to the S-100 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.