NBR1 Antibody - #DF12049
Product: | NBR1 Antibody |
Catalog: | DF12049 |
Description: | Rabbit polyclonal antibody to NBR1 |
Application: | WB IHC |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 140 kDa; 107kD(Calculated). |
Uniprot: | Q14596 |
RRID: | AB_2844854 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12049, RRID:AB_2844854.
Fold/Unfold
1A1 3B; 1A13B; B box protein; Cell migration-inducing gene 19 protein; KIAA0049; M17S2; Membrane component chromosome 17 surface marker 2; Membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); MIG 19; MIG19; Migration inducing protein 19; NBR 1; Nbr1; NBR1, autophagy cargo receptor; NBR1_HUMAN; Neighbor of BRCA1 gene 1; Neighbor of BRCA1 gene 1 protein; Next to BRCA1 gene 1 protein; Ovarian carcinoma antigen CA125; Protein 1A1-3B;
Immunogens
- Q14596 NBR1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEKLVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNICEDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKAEKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLPLQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLTLASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDPFPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKNVASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIEKPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLDAAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDEVQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGVEAGQEPAEAGERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPVTIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKALFAGPPVTAQPIISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNNDWYSQRY
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q14596 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S60 | Phosphorylation | Uniprot | |
K100 | Ubiquitination | Uniprot | |
K108 | Ubiquitination | Uniprot | |
K109 | Ubiquitination | Uniprot | |
S115 | Phosphorylation | Uniprot | |
S116 | Phosphorylation | Uniprot | |
K126 | Ubiquitination | Uniprot | |
K149 | Sumoylation | Uniprot | |
K149 | Ubiquitination | Uniprot | |
K172 | Ubiquitination | Uniprot | |
K176 | Ubiquitination | Uniprot | |
K274 | Ubiquitination | Uniprot | |
S276 | Phosphorylation | Uniprot | |
T277 | Phosphorylation | Uniprot | |
K291 | Ubiquitination | Uniprot | |
K295 | Ubiquitination | Uniprot | |
K299 | Ubiquitination | Uniprot | |
K313 | Acetylation | Uniprot | |
K317 | Ubiquitination | Uniprot | |
K320 | Ubiquitination | Uniprot | |
K328 | Ubiquitination | Uniprot | |
S334 | Phosphorylation | Uniprot | |
S340 | Phosphorylation | Uniprot | |
K394 | Ubiquitination | Uniprot | |
K399 | Ubiquitination | Uniprot | |
K405 | Ubiquitination | Uniprot | |
K411 | Ubiquitination | Uniprot | |
K426 | Ubiquitination | Uniprot | |
K427 | Ubiquitination | Uniprot | |
K464 | Ubiquitination | Uniprot | |
S486 | Phosphorylation | Uniprot | |
K492 | Ubiquitination | Uniprot | |
K499 | Ubiquitination | Uniprot | |
K515 | Ubiquitination | Uniprot | |
K537 | Ubiquitination | Uniprot | |
K539 | Ubiquitination | Uniprot | |
T581 | Phosphorylation | Uniprot | |
T586 | Phosphorylation | Uniprot | |
S590 | Phosphorylation | Uniprot | |
S596 | Phosphorylation | Uniprot | |
K601 | Ubiquitination | Uniprot | |
K617 | Ubiquitination | Uniprot | |
S622 | Phosphorylation | Uniprot | |
S625 | Phosphorylation | Uniprot | |
K627 | Ubiquitination | Uniprot | |
K629 | Ubiquitination | Uniprot | |
S656 | Phosphorylation | Uniprot | |
T658 | Phosphorylation | Uniprot | |
K672 | Ubiquitination | Uniprot | |
S673 | Phosphorylation | Uniprot | |
K767 | Ubiquitination | Uniprot | |
S824 | Phosphorylation | Uniprot | |
S825 | Phosphorylation | Uniprot | |
S833 | Phosphorylation | Uniprot | |
K887 | Ubiquitination | Uniprot | |
K898 | Ubiquitination | Uniprot |
Research Backgrounds
Acts probably as a receptor for selective autophagosomal degradation of ubiquitinated targets.
Cytoplasm. Cytoplasmic vesicle>Autophagosome. Lysosome. Cytoplasm>Myofibril>Sarcomere>M line.
Note: In cardiac muscles localizes to the sarcomeric M line (By similarity). Is targeted to lysosomes for degradation (PubMed:19250911).
Homooligomer and heterooligomer. Interacts with TRIM55 (By similarity). Interacts with SQSTM1, titin/TTN, RNF29, USP8, SQSTM1, MAP1LC3A, MAP1LC3B, MAP1LC3C, GABARAP, GABARAPL1 and GABARAPL2. Binds to ubiquitin and ubiquitinated proteins.
The PB1 domain mediates interaction with SQSTM1.
References
Application: IHC Species: Rat Sample: brain tissue
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.