GATA 3; GATA binding factor 3; GATA binding protein 3; GATA-binding factor 3; Gata3; GATA3_HUMAN; HDR; HDRS; MGC2346; MGC5199; MGC5445; Trans acting T cell specific transcription factor GATA 3; Trans-acting T-cell-specific transcription factor GATA-3; DCML; Endothelial transcription factor GATA 2; Endothelial transcription factor GATA-2; Endothelial transcription factor GATA2; FLJ45948; GATA 2; GATA binding protein 2; GATA-binding protein 2; Gata2; GATA2_HUMAN; IMD21; MGC2306; MONOMAC; NFE 1B; NFE1B; OTTHUMP00000216240;
WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Human, Mouse, Rat
Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
Rabbit
Polyclonal
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
GATA3 Antibody detects endogenous levels of total GATA3.
AB_2834800
Please cite this product as: Affinity Biosciences Cat# AF6233, RRID:AB_2834800.
Liquid
1mg/ml
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.
A synthesized peptide derived from human GATA3, corresponding to a region within the internal amino acids.
>>Visit The Human Protein Atlas
GATA2,GATA3
Observed Mol.Wt.: 47kD.
Predicted Mol.Wt.: 48kDa,51kDa(Calculated)..
Nucleus.
P23771 GATA3_HUMAN:
T-cells and endothelial cells.
P23769 GATA2_HUMAN:
Endothelial cells.
GATA2 Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'. Endothelial cells. 2 isoforms of the human protein are produced by alternative splicing.
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAMG
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'. Required for the T-helper 2 (Th2) differentiation process following immune and inflammatory responses.
Nucleus.
T-cells and endothelial cells.
Interacts with TBX21 ('Tyr-530' phosphorylated form).
Binds DNA via the 2 GATA-type zinc fingers. Each zinc finger may bind either adjacent sites in a palindromic motif, or a different DNA molecule allowing looping and long-range gene regulation.
The YxKxHxxxRP motif is critical for DNA-binding and function.
Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'.
Nucleus.
Endothelial cells.
Interacts with BRD3 (By similarity). Interacts with AR and CCAR1.
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.(View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation.(View pathway)
AF6233-BP
(Blocking peptide available as AF6233-BP)
$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).
Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.
Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Site | PTM Type | Enzyme | Source |
---|---|---|---|
Ubiquitination | Uniprot | ||
S110 | Phosphorylation | Uniprot | |
S115 | Phosphorylation | Uniprot | |
T156 | Phosphorylation | P24941 (CDK2) | Uniprot |
S162 | Phosphorylation | Uniprot | |
S166 | Phosphorylation | Uniprot | |
S172 | Phosphorylation | Uniprot | |
Y186 | Phosphorylation | Uniprot | |
K195 | Ubiquitination | Uniprot | |
R261 | Methylation | Uniprot | |
T271 | Phosphorylation | Uniprot | |
Y282 | Phosphorylation | Uniprot | |
Y290 | Phosphorylation | Uniprot | |
K292 | Acetylation | Uniprot | |
K304 | Acetylation | Uniprot | |
S308 | Phosphorylation | P17612 (PRKACA) | Uniprot |
T315 | Phosphorylation | Uniprot | |
S316 | Phosphorylation | Uniprot | |
Y344 | Phosphorylation | Uniprot | |
K346 | Acetylation | Uniprot | |
S369 | Phosphorylation | Uniprot | |
K371 | Acetylation | Uniprot | |
K373 | Acetylation | Uniprot | |
K374 | Acetylation | Uniprot | |
K376 | Acetylation | Uniprot | |
K377 | Ubiquitination | Uniprot | |
S381 | Phosphorylation | Uniprot |
Site | PTM Type | Enzyme | Source |
---|---|---|---|
S71 | Phosphorylation | Uniprot | |
S73 | Phosphorylation | Uniprot | |
R86 | Methylation | Uniprot | |
S119 | Phosphorylation | Uniprot | |
T176 | Phosphorylation | P06493 (CDK1) | Uniprot |
S182 | Phosphorylation | Uniprot | |
S186 | Phosphorylation | Uniprot | |
S192 | Phosphorylation | Uniprot | |
Y213 | Phosphorylation | Uniprot | |
S216 | Phosphorylation | Uniprot | |
S220 | Phosphorylation | Uniprot | |
S276 | Phosphorylation | Uniprot | |
S290 | Phosphorylation | Uniprot | |
Y314 | Phosphorylation | Uniprot | |
Y322 | Phosphorylation | Uniprot | |
Y376 | Phosphorylation | Uniprot | |
K389 | Sumoylation | Uniprot | |
S401 | Phosphorylation | P31749 (AKT1) | Uniprot |
K409 | Ubiquitination | Uniprot |