Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    GATA3 Antibody
  • Catalog No.
    AF6233
  • RRID
    AB_2834800
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)
  • UniProt
  • Mol.Wt
    47kD;
    48kDa,51kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

GATA 3; GATA binding factor 3; GATA binding protein 3; GATA-binding factor 3; Gata3; GATA3_HUMAN; HDR; HDRS; MGC2346; MGC5199; MGC5445; Trans acting T cell specific transcription factor GATA 3; Trans-acting T-cell-specific transcription factor GATA-3; DCML; Endothelial transcription factor GATA 2; Endothelial transcription factor GATA-2; Endothelial transcription factor GATA2; FLJ45948; GATA 2; GATA binding protein 2; GATA-binding protein 2; Gata2; GATA2_HUMAN; IMD21; MGC2306; MONOMAC; NFE 1B; NFE1B; OTTHUMP00000216240;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig(100%), Zebrafish(100%), Bovine(100%), Horse(100%), Sheep(100%), Rabbit(100%), Dog(100%), Chicken(100%), Xenopus(100%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

GATA3 Antibody detects endogenous levels of total GATA3.

RRID:

AB_2834800
Please cite this product as: Affinity Biosciences Cat# AF6233, RRID:AB_2834800.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human GATA3, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

GATA2,GATA3

Molecular Weight:

Observed Mol.Wt.: 47kD.
Predicted Mol.Wt.: 48kDa,51kDa(Calculated)..

Subcellular Location:

Nucleus.

Tissue Specificity:

P23771 GATA3_HUMAN:
T-cells and endothelial cells.

P23769 GATA2_HUMAN:
Endothelial cells.

Description:

GATA2 Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'. Endothelial cells. 2 isoforms of the human protein are produced by alternative splicing.

Sequence:
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHVPPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAMG

MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG

Research Background

Function:

Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'. Required for the T-helper 2 (Th2) differentiation process following immune and inflammatory responses.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

T-cells and endothelial cells.

Subunit Structure:

Interacts with TBX21 ('Tyr-530' phosphorylated form).

Similarity:

Binds DNA via the 2 GATA-type zinc fingers. Each zinc finger may bind either adjacent sites in a palindromic motif, or a different DNA molecule allowing looping and long-range gene regulation.

The YxKxHxxxRP motif is critical for DNA-binding and function.

Function:

Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'.

Subcellular Location:

Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Endothelial cells.

Subunit Structure:

Interacts with BRD3 (By similarity). Interacts with AR and CCAR1.

Research Fields

Research Fields:

· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.(View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation.(View pathway)

Reference Citations:

1). Wang W;Wang M;Xu J;Long F;Zhan X; et al. Overexpressed GATA3 enhances the sensitivity of colorectal cancer cells to oxaliplatin through regulating MiR-29b. Cancer Cell Int 2020 Jul 24;20:339. (PubMed: 32760217) [IF=4.175]

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF6233-BP
(Blocking peptide available as AF6233-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Horse
100%
Bovine
100%
Sheep
100%
Dog
100%
Xenopus
100%
Zebrafish
100%
Chicken
100%
Rabbit
100%
High similarity Medium similarity Low similarity No similarity
P23771/P23769 as Substrate
Site PTM Type Enzyme
Ubiquitination
S110 Phosphorylation
S115 Phosphorylation
T156 Phosphorylation P24941 (CDK2)
S162 Phosphorylation
S166 Phosphorylation
S172 Phosphorylation
Y186 Phosphorylation
K195 Ubiquitination
R261 Methylation
T271 Phosphorylation
Y282 Phosphorylation
Y290 Phosphorylation
K292 Acetylation
K304 Acetylation
S308 Phosphorylation P17612 (PRKACA)
T315 Phosphorylation
S316 Phosphorylation
Y344 Phosphorylation
K346 Acetylation
S369 Phosphorylation
K371 Acetylation
K373 Acetylation
K374 Acetylation
K376 Acetylation
K377 Ubiquitination
S381 Phosphorylation
Site PTM Type Enzyme
S71 Phosphorylation
S73 Phosphorylation
R86 Methylation
S119 Phosphorylation
T176 Phosphorylation P06493 (CDK1)
S182 Phosphorylation
S186 Phosphorylation
S192 Phosphorylation
Y213 Phosphorylation
S216 Phosphorylation
S220 Phosphorylation
S276 Phosphorylation
S290 Phosphorylation
Y314 Phosphorylation
Y322 Phosphorylation
Y376 Phosphorylation
K389 Sumoylation
S401 Phosphorylation P31749 (AKT1)
K409 Ubiquitination
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top