Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    RAB12 Antibody
  • Catalog No.
    DF12459
  • RRID
    AB_2845264
  • Source
    Rabbit
  • Application
    WB,IHC
  • Reactivity
    Human, Mouse
  • Prediction
    Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken
  • UniProt
  • Mol.Wt
    28 kD;
    27kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Putative Ras related protein Rab 12; RAB12; RAB12, member RAS oncogene family; RAB12_HUMAN; Ras-related protein Rab-12;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse

Predicted Reactivity:

Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

RAB12 Antibody detects endogenous levels of total RAB12.

RRID:

AB_2845264
Please cite this product as: Affinity Biosciences Cat# DF12459, RRID:AB_2845264.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human RAB12, corresponding to a region within C-terminal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

RAB12

Molecular Weight:

Observed Mol.Wt.: 28 kD.
Predicted Mol.Wt.: 27kDa(Calculated)..

Subcellular Location:

Golgi apparatus membrane.

Sequence:
MDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC

Research Background

Function:

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab may play a role in protein transport from recycling endosomes to lysosomes regulating, for instance, the degradation of the transferrin receptor. Involved in autophagy (By similarity).

Post-translational Modifications:

Phosphorylation of Ser-106 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM, CHML and RAB GDP dissociation inhibitors GDI1 and GDI2.

Subcellular Location:

Recycling endosome membrane>Lipid-anchor>Cytoplasmic side. Lysosome membrane>Lipid-anchor>Cytoplasmic side. Golgi apparatus membrane. Cytoplasmic vesicle>Autophagosome.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Interacts with RABIF. Interacts with OPTN (By similarity). Interacts with LRRK2; interaction facilitates phosphorylation of Ser-106. Interacts with GDI1, GDI2, CHM and CHML; these interactions are disrupted by phosphorylation on Ser-106. Interacts with RILPL1 and RILPL2; these interactions are dependent on phosphorylation of Ser-106.

Similarity:

Belongs to the small GTPase superfamily. Rab family.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF12459-BP
(Blocking peptide available as DF12459-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Horse
100%
Bovine
100%
Sheep
100%
Dog
100%
Chicken
100%
Rabbit
100%
Xenopus
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
Q6IQ22 as Substrate
Site PTM Type Enzyme
M1 Acetylation
R10 Methylation
S21 Phosphorylation
S25 Phosphorylation
T83 Phosphorylation
T98 Phosphorylation
S106 Phosphorylation
T108 Phosphorylation
S109 Phosphorylation
K156 Ubiquitination
K172 Ubiquitination
S220 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top