RAB3C Antibody - #DF12716
| Product: | RAB3C Antibody |
| Catalog: | DF12716 |
| Description: | Rabbit polyclonal antibody to RAB3C |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Zebrafish, Bovine, Rabbit |
| Mol.Wt.: | 28 kDa; 26kD(Calculated). |
| Uniprot: | Q96E17 |
| RRID: | AB_2845677 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12716, RRID:AB_2845677.
Fold/Unfold
RAB3C; RAB3C member RAS oncogene family; RAB3C_HUMAN; Ras related protein Rab3C; Ras-related protein Rab-3C;
Immunogens
- Q96E17 RAB3C_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q96E17 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| Y17 | Phosphorylation | Uniprot | |
| S22 | Phosphorylation | Uniprot | |
| S23 | Phosphorylation | Uniprot | |
| Y29 | Phosphorylation | Uniprot | |
| Y50 | Phosphorylation | Uniprot | |
| S54 | Phosphorylation | Uniprot | |
| T86 | Phosphorylation | Uniprot | |
| Y92 | Phosphorylation | Uniprot | |
| T96 | Phosphorylation | Uniprot | |
| Y99 | Phosphorylation | Uniprot | |
| Y100 | Phosphorylation | Uniprot | |
| Y110 | Phosphorylation | Uniprot | |
| Y131 | Phosphorylation | Uniprot | |
| K181 | Ubiquitination | Uniprot |
Research Backgrounds
Protein transport. Probably involved in vesicular traffic (By similarity).
Phosphorylation of Thr-94 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM, CHML and RAB GDP dissociation inhibitor GDI2.
Cell membrane>Lipid-anchor>Cytoplasmic side.
Expressed in brain, placenta and lung.
Interacts with RIMS1, RIMS2, RPH3A and RPH3AL (By similarity). Interacts with GDI2, CHM and CHML; phosphorylation at Thr-94 disrupts these interactions.
Belongs to the small GTPase superfamily. Rab family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.