REEP1 Antibody - #DF12719
| Product: | REEP1 Antibody |
| Catalog: | DF12719 |
| Description: | Rabbit polyclonal antibody to REEP1 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog |
| Mol.Wt.: | 22 kDa; 22kD(Calculated). |
| Uniprot: | Q9H902 |
| RRID: | AB_2845680 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12719, RRID:AB_2845680.
Fold/Unfold
C2orf23; Chromosome 2 open reading frame 23; FLJ13110; Receptor accessory protein 1; Receptor expression-enhancing protein 1; Reep1; REEP1_HUMAN; SPG31;
Immunogens
- Q9H902 REEP1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MVSWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9H902 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S84 | Phosphorylation | Uniprot | |
| S85 | Phosphorylation | Uniprot | |
| K99 | Ubiquitination | Uniprot | |
| K111 | Ubiquitination | Uniprot | |
| S114 | Phosphorylation | Uniprot | |
| S138 | Phosphorylation | Uniprot | |
| S150 | Phosphorylation | Uniprot | |
| S152 | Phosphorylation | Uniprot |
Research Backgrounds
Required for endoplasmic reticulum (ER) network formation, shaping and remodeling; it links ER tubules to the cytoskeleton. May also enhance the cell surface expression of odorant receptors. May play a role in long-term axonal maintenance.
Membrane. Mitochondrion membrane>Multi-pass membrane protein. Endoplasmic reticulum.
Note: Localizes to endoplasmic reticulum tubular network.
Expressed in circumvallate papillae and testis.
Interacts with SPAST and ATL1; it preferentially interacts with SPAST isoform 1. Interacts (via C-terminus) with microtubules. Interacts with odorant receptor proteins (By similarity). Interacts with ZFYVE27.
Belongs to the DP1 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.