ST8SIA2 Antibody - #DF12754
Product: | ST8SIA2 Antibody |
Catalog: | DF12754 |
Description: | Rabbit polyclonal antibody to ST8SIA2 |
Application: | WB |
Reactivity: | Human, Mouse, Rat, Monkey |
Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus |
Mol.Wt.: | 42 kDa; 42kD(Calculated). |
Uniprot: | Q92186 |
RRID: | AB_2845715 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12754, RRID:AB_2845715.
Fold/Unfold
alpha 2 8 sialyltransferase 8B 1; Alpha 2 8 sialyltransferase 8B; HsT19690; MGC116854; MGC116857; Sialyltransferase 8 (alpha 2 8 sialytransferase) B; Sialyltransferase 8B; Sialyltransferase X; Sialyltransferase8B; SialyltransferaseX; sialytransferase St8Sia II; SIAT 8 B; SIAT 8B; SIAT8 B; SIAT8B; ST8 alpha N acetyl neuraminide alpha 2 8 sialyltransferase 2; ST8SIA II; ST8SIA2; ST8SIAII; STX;
Immunogens
Highly expressed in fetal brain, kidney and heart and to a much lesser extent in adult heart and thymus.
- Q92186 SIA8B_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFGTCAIVGNSGVLLNSGCGQEIDAHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHSLNGSILWIPAFMARGGKERVEWVNELILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q92186 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
K98 | Ubiquitination | Uniprot | |
Y282 | Phosphorylation | Uniprot | |
T285 | Phosphorylation | Uniprot | |
T347 | Phosphorylation | Uniprot | |
S357 | Phosphorylation | Uniprot |
Research Backgrounds
May transfer sialic acid through alpha-2,8-linkages to the alpha-2,3-linked and alpha-2,6-linked sialic acid of N-linked oligosaccharides of glycoproteins and may be involved in PSA (polysialic acid) expression.
Golgi apparatus membrane>Single-pass type II membrane protein.
Highly expressed in fetal brain, kidney and heart and to a much lesser extent in adult heart and thymus.
Belongs to the glycosyltransferase 29 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.