SUB1 Antibody - #DF12758
| Product: | SUB1 Antibody |
| Catalog: | DF12758 |
| Description: | Rabbit polyclonal antibody to SUB1 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Dog, Chicken |
| Mol.Wt.: | 18 kDa; 14kD(Calculated). |
| Uniprot: | P53999 |
| RRID: | AB_2845719 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12758, RRID:AB_2845719.
Fold/Unfold
Activated RNA polymerase II transcriptional coactivator p15; Interferon related developmental regulator 1; MGC102747; p14; P15; PC4; PC4 LSB; Positive cofactor 4; RPO2TC1; Sub1; SUB1 homolog; TCP4_HUMAN;
Immunogens
- P53999 TCP4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P53999 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| S4 | Phosphorylation | Uniprot | |
| S9 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| S10 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| S11 | Phosphorylation | Uniprot | |
| S12 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| S13 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| S15 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| S17 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| S19 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
| K29 | Acetylation | Uniprot | |
| K29 | Ubiquitination | Uniprot | |
| K35 | Acetylation | Uniprot | |
| K35 | Ubiquitination | Uniprot | |
| K38 | Sumoylation | Uniprot | |
| S50 | Phosphorylation | Uniprot | |
| S51 | Phosphorylation | Uniprot | |
| S52 | Phosphorylation | Uniprot | |
| K53 | Acetylation | Uniprot | |
| K53 | Ubiquitination | Uniprot | |
| S55 | Phosphorylation | Uniprot | |
| S56 | Phosphorylation | Uniprot | |
| S57 | Phosphorylation | Uniprot | |
| S58 | Phosphorylation | Uniprot | |
| K68 | Acetylation | Uniprot | |
| K68 | Sumoylation | Uniprot | |
| K68 | Ubiquitination | Uniprot | |
| K80 | Ubiquitination | Uniprot | |
| K97 | Acetylation | Uniprot | |
| K97 | Sumoylation | Uniprot | |
| K97 | Ubiquitination | Uniprot | |
| K101 | Ubiquitination | Uniprot | |
| S104 | Phosphorylation | Uniprot | |
| S111 | Phosphorylation | Uniprot | |
| K114 | Ubiquitination | Uniprot | |
| S118 | Phosphorylation | Uniprot | |
| K126 | Ubiquitination | Uniprot |
Research Backgrounds
General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery. May be involved in stabilizing the multiprotein transcription complex. Binds single-stranded DNA. Also binds, in vitro, non-specifically to double-stranded DNA (ds DNA).
Activity is controlled by protein kinases that target the regulatory region. Phosphorylation inactivates both ds DNA-binding and cofactor function, but does not affect binding to ssDNA. Seems to be phosphorylated in vivo by CK2 in at least 7 sites in the N-terminal Ser-rich region.
Nucleus.
Homodimer. Interacts with CSTF2.
Belongs to the transcriptional coactivator PC4 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.