UCK2 Antibody - #DF12789
| Product: | UCK2 Antibody |
| Catalog: | DF12789 |
| Description: | Rabbit polyclonal antibody to UCK2 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 35 kDa, 40 kDa; 29kD(Calculated). |
| Uniprot: | Q9BZX2 |
| RRID: | AB_2845750 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12789, RRID:AB_2845750.
Fold/Unfold
Cytidine monophosphokinase 2; TSA903; UCK2; UK; UMPK; Uridine cytidine kinase 2; Uridine monophosphokinase 2;
Immunogens
According to PubMed:8812458; testis-specific. According to PubMed:11306702, placenta-specific.
- Q9BZX2 UCK2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9BZX2 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| A2 | Acetylation | Uniprot | |
| K33 | Ubiquitination | Uniprot | |
| K39 | Ubiquitination | Uniprot | |
| Y51 | Phosphorylation | Uniprot | |
| K54 | Ubiquitination | Uniprot | |
| K73 | Ubiquitination | Uniprot | |
| K75 | Ubiquitination | Uniprot | |
| K78 | Ubiquitination | Uniprot | |
| K96 | Ubiquitination | Uniprot | |
| K99 | Ubiquitination | Uniprot | |
| K105 | Ubiquitination | Uniprot | |
| T157 | Phosphorylation | Uniprot | |
| R162 | Methylation | Uniprot | |
| T200 | Phosphorylation | Uniprot | |
| K201 | Ubiquitination | Uniprot | |
| K202 | Ubiquitination | Uniprot | |
| K235 | Ubiquitination | Uniprot | |
| T238 | Phosphorylation | Uniprot | |
| Y245 | Phosphorylation | Uniprot | |
| T246 | Phosphorylation | Uniprot | |
| S248 | Phosphorylation | Uniprot | |
| S254 | Phosphorylation | Uniprot |
Research Backgrounds
Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine.
According to; testis-specific. According to placenta-specific.
Homotetramer.
Belongs to the uridine kinase family.
Research Fields
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Xenobiotics biodegradation and metabolism > Drug metabolism - other enzymes.
· Metabolism > Global and overview maps > Metabolic pathways.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.