COQ4 Antibody - #DF12909
| Product: | COQ4 Antibody |
| Catalog: | DF12909 |
| Description: | Rabbit polyclonal antibody to COQ4 |
| Application: | WB |
| Reactivity: | Human, Mouse, Rat, Monkey |
| Prediction: | Pig, Zebrafish, Horse, Sheep, Rabbit, Dog, Chicken |
| Mol.Wt.: | 32 kDa; 30kD(Calculated). |
| Uniprot: | Q9Y3A0 |
| RRID: | AB_2845870 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF12909, RRID:AB_2845870.
Fold/Unfold
CGI 92; Coenzyme Q biosynthesis protein 4 homolog; coq4; COQ4_HUMAN; mitochondrial; Ubiquinone biosynthesis protein COQ4 homolog;
Immunogens
- Q9Y3A0 COQ4_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKGLLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9Y3A0 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| S108 | Phosphorylation | Uniprot | |
| K114 | Ubiquitination | Uniprot |
Research Backgrounds
Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides.
Mitochondrion inner membrane>Peripheral membrane protein>Matrix side.
Expressed ubiquitously, but at high levels in liver, lung and pancreas.
Component of a multi-subunit COQ enzyme complex, composed of at least COQ3, COQ4, COQ5, COQ6, COQ7 and COQ9.
Belongs to the COQ4 family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.