Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    Phospho-MLC2 (Ser15) Antibody
  • Catalog No.
    AF8618
  • RRID
    AB_2846214
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Horse, Sheep, Rabbit, Dog, Chicken
  • UniProt
  • Mol.Wt
    18kD;
    19kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Cardiac myosin light chain-2;Cardiac ventricular myosin light chain 2;CMH10;MLC 2v;MLC-2;MLC-2v;MLC2;MLRV_HUMAN;MYL 2;MYL2;Myosin light chain 2 regulatory cardiac slow;Myosin light polypeptide 2 regulatory cardiac slow;Myosin regulatory light chain 2;Myosin regulatory light chain 2 ventricular/cardiac muscle isoform;Regulatory light chain of myosin;RLC of myosin;Slow cardiac myosin regulatory light chain 2;ventricular/cardiac muscle isoform;

Applications:

WB 1:200-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Horse, Sheep, Rabbit, Dog, Chicken

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.

Specificity:

Phospho-MLC2 (Ser15) Antibody detects endogenous levels of MLC2 only when phosphorylated at Ser15.

RRID:

AB_2846214
Please cite this product as: Affinity Biosciences Cat# AF8618, RRID:AB_2846214.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human MLC2 around the phosphorylation site of Ser15.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

MYL2

Molecular Weight:

Observed Mol.Wt.: 18kD.
Predicted Mol.Wt.: 19kDa(Calculated)..

Sequence:
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD

Research Background

Function:

Contractile protein that plays a role in heart development and function (By similarity). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm stiffness and promoting myosin head diffusion; as a consequence of the increase in maximum contraction force and calcium sensitivity of contraction force. These events altogether slow down myosin kinetics and prolong duty cycle resulting in accumulated myosins being cooperatively recruited to actin binding sites to sustain thin filament activation as a means to fine-tune myofilament calcium sensitivity to force (By similarity). During cardiogenesis plays an early role in cardiac contractility by promoting cardiac myofibril assembly (By similarity).

Post-translational Modifications:

N-terminus is methylated by METTL11A/NTM1.

Phosphorylated by MYLK3 and MYLK2; promotes cardiac muscle contraction and function (By similarity). Dephosphorylated by PPP1CB complexed to PPP1R12B (By similarity). The phosphorylated form in adult is expressed as gradients across the heart from endocardium (low phosphorylation) to epicardium (high phosphorylation); regulates cardiac torsion and workload distribution (By similarity).

Subcellular Location:

Cytoplasm>Myofibril>Sarcomere>A band.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

Myosin is a hexamer of 2 heavy chains and 4 light chains. Interacts with MYOC.

Research Fields

Research Fields:

· Cellular Processes > Cellular community - eukaryotes > Focal adhesion.(View pathway)
· Cellular Processes > Cellular community - eukaryotes > Tight junction.(View pathway)
· Cellular Processes > Cell motility > Regulation of actin cytoskeleton.(View pathway)
· Environmental Information Processing > Signal transduction > Apelin signaling pathway.(View pathway)
· Human Diseases > Cardiovascular diseases > Hypertrophic cardiomyopathy (HCM).
· Human Diseases > Cardiovascular diseases > Dilated cardiomyopathy (DCM).
· Organismal Systems > Circulatory system > Cardiac muscle contraction.(View pathway)
· Organismal Systems > Circulatory system > Adrenergic signaling in cardiomyocytes.(View pathway)
· Organismal Systems > Immune system > Leukocyte transendothelial migration.(View pathway)

Reference Citations:

1). Liu Y;Wu J;Chen L;Wu X;Gan Y;Xu N;Li M;Luo H;Guan F;Su Z;Chen J;Li Y; et al. β-patchoulene simultaneously ameliorated dextran sulfate sodium-induced colitis and secondary liver injury in mice via suppressing colonic leakage and flora imbalance. Biochem Pharmacol 2020 Oct 2;114260. (PubMed: 33017576) [IF=4.960]

2). et al. Calycosin-7-O-β-D-Glucoside Treatment Promotes Axonal Regeneration via Rho/ROCK Pathway After Ischemia/Reperfusion Injury.

3). et al. Brusatol-Enriched Brucea javanica Oil Ameliorated Dextran Sulfate Sodium-Induced Colitis in Mice: Involvement of NF-κB and RhoA/ROCK Signaling Pathways.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF8618-BP
(Blocking peptide available as AF8618-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Horse
100%
Sheep
100%
Dog
100%
Chicken
100%
Rabbit
100%
Xenopus
75%
Pig
0%
Bovine
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
P10916 as Substrate
Site PTM Type Enzyme
S15 Phosphorylation Q15746 (MYLK)
S19 Phosphorylation Q5VT25 (CDC42BPA)
T80 Phosphorylation
T98 Phosphorylation
K104 Acetylation
K111 Acetylation
Y118 Phosphorylation
T124 Phosphorylation
Y152 Phosphorylation
K153 Acetylation
K165 Acetylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top