Product: Cleaved-Caspase 7 (Asp198) Antibody
Catalog: AF4023
Description: Rabbit polyclonal antibody to Cleaved-Caspase 7 (Asp198)
Application: WB
Cited expt.: WB
Reactivity: Human, Mouse
Prediction: Pig, Bovine, Horse, Sheep, Rabbit, Dog
Mol.Wt.: 20kDa, 25 kDa(Observed); 34kD(Calculated).
Uniprot: P55210
RRID: AB_2846219

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000
*The optimal dilutions should be determined by the end user. For optimal experimental results, antibody reuse is not recommended.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human, Mouse
Prediction:
Pig(100%), Bovine(%), Horse(%), Sheep(%), Rabbit(%), Dog(%)
Clonality:
Polyclonal
Specificity:
Cleaved-Caspase 7 (Asp198) Antibody detects endogenous levels of fragment of activated Caspase 7 resulting from cleavage adjacent to Asp198.
RRID:
AB_2846219
Cite Format: Affinity Biosciences Cat# AF4023, RRID:AB_2846219.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Apoptotic protease Mch-3; Apoptotic protease MCH3; CASP-7; CASP7; CASP7_HUMAN; Caspase 7; Caspase 7 apoptosis related cysteine peptidase; Caspase-7 subunit p11; Caspase7; CMH 1; CMH-1; CMH1; ICE LAP3; ICE-LAP3; ICE-like apoptotic protease 3; LICE2; MCH3;

Immunogens

Immunogen:

A synthesized peptide derived from human Caspase 7.

Uniprot:
Gene(ID):
Expression:
P55210 CASP7_HUMAN:

Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.

Sequence:
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Pig
100
Horse
100
Bovine
100
Sheep
100
Rabbit
100
Dog
86
Zebrafish
67
Xenopus
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

Research Backgrounds

Function:

Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

PTMs:

Cleavages by granzyme B or caspase-10 generate the two active subunits. Propeptide domains can also be cleaved efficiently by caspase-3. Active heterodimers between the small subunit of caspase-7 and the large subunit of caspase-3, and vice versa, also occur.

Subcellular Location:

Cytoplasm.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.

Family&Domains:

Belongs to the peptidase C14A family.

Research Fields

· Cellular Processes > Cell growth and death > Apoptosis.   (View pathway)

· Cellular Processes > Cell growth and death > Apoptosis - multiple species.   (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway.   (View pathway)

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

References

1). Upregulation of BCL-2 by acridone derivative through gene promoter i-motif for alleviating liver damage of NAFLD/NASH. NUCLEIC ACIDS RESEARCH, 2020 (PubMed: 32710621) [IF=16.6]

Application: WB    Species: mouse    Sample: liver

Figure 7. Effect of A22 on ameliorating apoptosis, ER stress, inflammation, metabolic syndrome, and fibrogenesis in HF diet-fed mice. (A) Effect of A22 on BCL-2 gene transcription. (B) Effect of A22 on BAX gene transcription. (C) Effect of A22 on expressions of apoptosis-related proteins in liver. The extracted proteins from the liver were immunoblotted with specific antibodies, and quantified based on the loading control of ACTIN. (D) Effect of A22 on ER stress. The UPR proteins (IRE-1, PERK, elF-2 and CHOP) were analyzed by using western Blot. (E) Effect of A22 on expressions of inflammatory factors. (F) Effect of A22 on expressions of fibrogenic proteins.

2). TIMM8B promotes oxidative phosphorylation and glycolysis by inhibiting the mtROS/ASK1/JNK signaling pathway in ovarian cancer. Biology direct, 2025 (PubMed: 40597377) [IF=5.5]

3). WTAP-Mediated m6A Modification of circSMOC1 Accelerates the Tumorigenesis of Non-Small Cell Lung Cancer by Regulating miR-612/CCL28 Axis. Journal of cellular and molecular medicine, 2024 (PubMed: 39632285) [IF=5.3]

4). Excessive mechanical stress induces chondrocyte apoptosis through TRPV4 in an anterior cruciate ligament-transected rat osteoarthritis model. LIFE SCIENCES, 2019 (PubMed: 31055086) [IF=5.2]

Application: WB    Species: rat    Sample: chondrocytes

Fig. 5.| Excessive mechanical stress stimulated caspase-8-dependent apoptotic signaling pathway in chondrocytes by activating TRPV4. (A) TRPV4, calmodulin,FADD, cleaved caspase-8, cleaved caspase-3, cleaved caspase-6, and cleaved caspase-7 protein expression was detected by western blotting.

5). Fufang Baizhi tincture protects melanocytes from oxidative stress by targeting CASP7-mediated apoptosis and EP300-associated transcriptional regulation. Journal of ethnopharmacology, 2026 (PubMed: 41713816) [IF=4.8]

6). Costunolide attenuates oxygen‑glucose deprivation/reperfusion‑induced mitochondrial‑mediated apoptosis in PC12 cells. Molecular Medicine Reports, 2021 (PubMed: 33786628) [IF=3.4]

Application: WB    Species: Rat    Sample: PC12 cells

Figure 8. Effects of CT on the expression of Apaf-1, Bcl-2, Bax, cleaved-Caspase-9, cleaved-Caspase-7, cleaved-Caspase-3 in PC12 cells following OGD/R. The stripe diagram represents Western blot analysis of Apaf-1, Bcl-2, Bax, cleaved-Caspase-9, cleaved-Caspase-7, cleaved-Caspase-3, procaspase-9, procaspase-7 and procaspase-3. α-tubulin was usedd as the loading control. The bar chart represents the quantitative analysis of Apaf-1, Bcl-2, Bax, cleaved-Caspase-9/procaspase-9, cleaved-Caspase-7/procaspase-7 and cleaved-Caspase-3/procaspase-3 expression. Values are presented as the mean ± standard deviation (n=3). #P<0.05, compared with the control group; *P<0.05, compared with OGD/R group. CT, costunolide; OGD/R, oxygen-glucose deprivation/reperfusion.

7). TMEM97 is transcriptionally activated by YY1 and promotes colorectal cancer progression via the GSK-3β/β-catenin signaling pathway. Human Cell, 2022 (PubMed: 35907137) [IF=3.4]

8). Lappaconitine sulfate inhibits proliferation and induces mitochondrial-mediated apoptosis via regulating PI3K/AKT/GSK3β signaling pathway in HeLa cells. Naunyn-Schmiedeberg's Archives of Pharmacology, 2023 (PubMed: 37306713) [IF=3.1]

9). Lappaconitine Sulfate Inhibits Proliferation and Induces Apoptosis in Human Hepatocellular Carcinoma HepG2 Cells through the Reactive Oxygen Species-Dependent Mitochondrial Pathway. PHARMACOLOGY, 2020 (PubMed: 32062649) [IF=2.9]

Application: WB    Species: Human    Sample: HepG2 cells

Fig. 2. LS induced apoptosis of HepG2 cells. a, b Apoptosis was analyzed by flow cytometry after treatment with LS for 48 h. c, d The apoptosis-related proteins were determined by western blotting after treatment with LS for 24 h. Cells were pretreated with 60 μmol/L z-VAD-fmk for 1.5 h and then incubated with 400 μg/mL LS for 48 and 24 h, respectively, (e) the cell viability was examined by CCK-8 assay and (f, g) the proteins were examined by western blotting. Data are expressed as mean ± SD (n = 3). * p < 0.05, ** p < 0.01 compared with control group. ++ p < 0.01 represent the significant difference between HepG2 and HUVEC cells at uniform concentration. ## p < 0.01 represent the significant difference between LS and LS + z-VAD-fmk. LS, lappaconitine sulfate.

10). RHBDD1 induces cell cycle arrest in TP53-mutant NSCLC cells by promoting endoplasmic reticulum-associated degradation of p53 and DNA-PKcs. European journal of medical research, 2025 (PubMed: 41013641) [IF=2.8]

Application: WB    Species: human    Sample:

Fig. 5 RHBDD1 Regulates DNA-PKcs and p53 Levels in an ERAD-Dependent Manner. A ERAD marker analysis in sh-RHBDD1- or pcDNA-RHBDD1-transfected cells treated with STL127705 or Nutlin-3a, assessed by western blotting. B Relative protein levels in sh-RHBDD1 transfected cells. C Apoptosis induced by cisplatin in pcDNA-RHBDD1-transfected A549 and NCI-H596 cells. Data are shown as mean ± SD. N = 3 for western blot analysis. *p 

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.