PHAP1 Antibody - #DF13532

Product: | PHAP1 Antibody |
Catalog: | DF13532 |
Description: | Rabbit polyclonal antibody to PHAP1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse, Rat |
Prediction: | Pig, Bovine, Sheep |
Mol.Wt.: | 28kDa; 29kD(Calculated). |
Uniprot: | P39687 |
RRID: | AB_2846551 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF13532, RRID:AB_2846551.
Fold/Unfold
acidic (leucine-rich) nuclear phosphoprotein 32 family, member A; Acidic leucine-rich nuclear phosphoprotein 32 family member A; Acidic nuclear phosphoprotein 32 family member A; Acidic nuclear phosphoprotein pp32; AN32A_HUMAN; ANP32A; C15orf1; Cerebellar leucine rich acidic nuclear protein; Hepatopoietin Cn; HPPCn; I1PP2A; Inhibitor 1 of protein phosphatase 2A; inhibitor-1 of protein phosphatase-2A; Lanp; Leucine rich acidic nuclear protein; Leucine-rich acidic nuclear protein; MAPM; Mapmodulin; MGC119787; MGC150373; PHAPI; Potent heat stable protein phosphatase 2A inhibitor I1PP2A; Potent heat-stable protein phosphatase 2A inhibitor I1PP2A; PP32; Putative HLA DR associated protein I; Putative HLA-DR-associated protein I; Putative human HLA class II associated protein I; Putative human HLA class II-associated protein;
Immunogens
Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate nucleus, corpus callosum, hippocampus and thalamus), with highest levels in amygdala.
- P39687 AN32A_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - P39687 As Substrate
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
R12 | Methylation | Uniprot | |
T15 | Phosphorylation | Uniprot | |
S17 | Phosphorylation | Uniprot | |
K20 | Ubiquitination | Uniprot | |
S27 | Phosphorylation | Uniprot | |
S29 | Phosphorylation | Uniprot | |
K68 | Ubiquitination | Uniprot | |
R75 | Methylation | Uniprot | |
S77 | Phosphorylation | Uniprot | |
K86 | Ubiquitination | Uniprot | |
C87 | S-Nitrosylation | Uniprot | |
S96 | Phosphorylation | Uniprot | |
K99 | Ubiquitination | Uniprot | |
K101 | Acetylation | Uniprot | |
K101 | Ubiquitination | Uniprot | |
S104 | Phosphorylation | Uniprot | |
K110 | Acetylation | Uniprot | |
K116 | Ubiquitination | Uniprot | |
S117 | Phosphorylation | Uniprot | |
C123 | S-Nitrosylation | Uniprot | |
T126 | Phosphorylation | Uniprot | |
R132 | Methylation | Uniprot | |
K137 | Ubiquitination | Uniprot | |
Y148 | Phosphorylation | Uniprot | |
R150 | Methylation | Uniprot | |
S158 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
Y163 | Phosphorylation | Uniprot | |
S204 | Phosphorylation | P68400 (CSNK2A1) | Uniprot |
K238 | Acetylation | Uniprot | |
K238 | Methylation | Uniprot |
Research Backgrounds
Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1-mediated transcriptional repression.
Phosphorylated on serine residues.
The N-terminus is blocked.
Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group (By similarity).
Nucleus. Cytoplasm. Endoplasmic reticulum.
Note: Translocates to the cytoplasm during the process of neuritogenesis (By similarity). Shuttles between nucleus and cytoplasm.
Expressed in all tissues tested. Highly expressed in kidney and skeletal muscle, moderate levels of expression in brain, placenta and pancreas, and weakly expressed in lung. Found in all regions of the brain examined (amygdala, caudate nucleus, corpus callosum, hippocampus and thalamus), with highest levels in amygdala.
Component of the SET complex, composed of at least ANP32A, APEX1, HMGB2, NME1, SET and TREX1. Directly interacts with SET. Interacts with ATXN1/SCA1. Interacts with MAP1B. Interacts with ELAVL1. Part of the INHAT (inhibitor of histone acetyltransferases) complex. Interacts with E4F1.
Belongs to the ANP32 family.
References
Application: WB Species: Mice Sample: HCC tissues and normal liver tissues
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.