Product: Phospho-PBK/TOPK (Ser32) Antibody
Catalog: AF3556
Description: Rabbit polyclonal antibody to Phospho-PBK/TOPK (Ser32)
Application: WB IHC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 36kD(Calculated).
Uniprot: Q96KB5
RRID: AB_2846870

View similar products>>

   Size Price Inventory
 100ul $350 In stock
 200ul $450 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
Phospho-PBK/TOPK (Ser32) Antibody detects endogenous levels of PBK/TOPK only when phosphorylated at Ser32.
RRID:
AB_2846870
Cite Format: Affinity Biosciences Cat# AF3556, RRID:AB_2846870.
Conjugate:
Unconjugated.
Purification:
The antibody is from purified rabbit serum by affinity purification via sequential chromatography on phospho-peptide and non-phospho-peptide affinity columns.
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Cancer/testis antigen 84; CT84; Epididymis luminal protein 164; FLJ14385; HEL164; Lymphokine activated killer T cell originated protein kinase; Lymphokine-activated killer T-cell-originated protein kinase; MAPKK like protein kinase; MAPKK-like protein kinase; Nori 3; Nori-3; Nori3; PBK; PDZ binding kinase; PDZ-binding kinase; Serine/threonine protein kinase; Spermatogenesis related protein kinase; Spermatogenesis-related protein kinase; SPK; T LAK cell originated protein kinase; T-LAK cell-originated protein kinase; TOPK; TOPK_HUMAN;

Immunogens

Immunogen:

A synthesized peptide derived from human PBK/TOPK around the phosphorylation site of Ser32.

Uniprot:
Gene(ID):
Expression:
Q96KB5 TOPK_HUMAN:

Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules.

Sequence:
MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV

PTMs - Q96KB5 As Substrate

Site PTM Type Enzyme
M1 Acetylation
S5 Phosphorylation
K8 Sumoylation
K8 Ubiquitination
T9 Phosphorylation P06493 (CDK1)
S11 Phosphorylation
K12 Acetylation
K12 Sumoylation
K12 Ubiquitination
S14 Phosphorylation
K16 Acetylation
K17 Acetylation
S19 Phosphorylation
S23 Phosphorylation
T24 Phosphorylation
T26 Phosphorylation
S32 Phosphorylation
Y47 Phosphorylation
K50 Ubiquitination
S52 Phosphorylation
S57 Phosphorylation
S59 Phosphorylation
K64 Acetylation
K64 Sumoylation
K64 Ubiquitination
K65 Sumoylation
K65 Ubiquitination
Y74 Phosphorylation P12931 (SRC)
S76 Phosphorylation
Y78 Phosphorylation
K80 Ubiquitination
K87 Acetylation
K87 Ubiquitination
K90 Ubiquitination
S91 Phosphorylation
Y100 Phosphorylation
S122 Phosphorylation
K132 Ubiquitination
K155 Sumoylation
K155 Ubiquitination
K161 Ubiquitination
K162 Sumoylation
K162 Ubiquitination
K169 Sumoylation
K169 Ubiquitination
S171 Phosphorylation
K176 Sumoylation
K176 Ubiquitination
T181 Phosphorylation
T198 Phosphorylation
K213 Ubiquitination
T260 Phosphorylation
Y272 Phosphorylation P12931 (SRC)
S310 Phosphorylation

PTMs - Q96KB5 As Enzyme

Substrate Site Source
P05412 (JUN) S63 Uniprot
P05412 (JUN) S73 Uniprot
P25963 (NFKBIA) S32 Uniprot
P31749 (AKT1) S473 Uniprot
P68431 (HIST1H3J) S11 Uniprot
P81274 (GPSM2) T457 Uniprot
Q06830 (PRDX1) S32 Uniprot

Research Backgrounds

Function:

Phosphorylates MAP kinase p38. Seems to be active only in mitosis. May also play a role in the activation of lymphoid cells. When phosphorylated, forms a complex with TP53, leading to TP53 destabilization and attenuation of G2/M checkpoint during doxorubicin-induced DNA damage.

PTMs:

Phosphorylated; in a cell-cycle dependent manner at mitosis.

Tissue Specificity:

Expressed in the testis and placenta. In the testis, restrictedly expressed in outer cell layer of seminiferous tubules.

Subunit Structure:

Interacts with DLG1 and TP53.

Family&Domains:

Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.