Product: GAP43 Antibody
Catalog: AF6715
Description: Rabbit polyclonal antibody to GAP43
Application: IF/ICC
Reactivity: Human, Mouse, Rat
Mol.Wt.: 25kD(Calculated).
Uniprot: P17677
RRID: AB_2847438

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
GAP43 Antibody detects endogenous levels of total GAP43.
RRID:
AB_2847438
Cite Format: Affinity Biosciences Cat# AF6715, RRID:AB_2847438.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

Axonal membrane protein GAP 43; Axonal membrane protein GAP-43; B 50; Calmodulin binding protein P 57; F1; GAP 43; GAP43; Growth Associated Protein 43; Growth-associated protein 43; Nerve Growth Related Peptide; Nerve growth related peptide GAP43; NEUM_HUMAN; Neural phosphoprotein B 50; Neural phosphoprotein B-50; Neuromodulin; Neuron growth associated protein 43; PP46; Protein F1; QtrA-11580; QtrA-13071;

Immunogens

Immunogen:

A synthesized peptide derived from human GAP43.

Uniprot:
Gene(ID):
Sequence:
MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

PTMs - P17677 As Substrate

Site PTM Type Enzyme
T36 Phosphorylation
K37 Ubiquitination
S41 Phosphorylation Q02156 (PRKCE)
T107 Phosphorylation
S109 Phosphorylation
S131 Phosphorylation
S142 Phosphorylation
T144 Phosphorylation
S147 Phosphorylation
T148 Phosphorylation
S151 Phosphorylation
S154 Phosphorylation
T181 Phosphorylation
K216 Methylation

Research Backgrounds

Function:

This protein is associated with nerve growth. It is a major component of the motile 'growth cones' that form the tips of elongating axons. Plays a role in axonal and dendritic filopodia induction.

PTMs:

Phosphorylated (By similarity). Phosphorylation of this protein by a protein kinase C is specifically correlated with certain forms of synaptic plasticity (By similarity).

Palmitoylation by ARF6 is essential for plasma membrane association and axonal and dendritic filopodia induction. Deacylated by LYPLA2.

Subcellular Location:

Cell membrane>Peripheral membrane protein>Cytoplasmic side. Cell projection>Growth cone membrane>Peripheral membrane protein>Cytoplasmic side. Cell junction>Synapse. Cell projection>Filopodium membrane>Peripheral membrane protein. Perikaryon. Cell projection>Dendrite. Cell projection>Axon. Cytoplasm.
Note: Cytoplasmic surface of growth cone and synaptic plasma membranes.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Subunit Structure:

Identified in a complex containing FGFR4, NCAM1, CDH2, PLCG1, FRS2, SRC, SHC1, GAP43 and CTTN (By similarity). Interacts (via IQ domain) with calmodulin (By similarity). Binds calmodulin with a greater affinity in the absence of Ca(2+) than in its presence (By similarity).

Family&Domains:

Belongs to the neuromodulin family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.