Syntenin 2 Antibody - #DF13830
Product: | Syntenin 2 Antibody |
Catalog: | DF13830 |
Description: | Rabbit polyclonal antibody to Syntenin 2 |
Application: | ELISA(peptide) |
Reactivity: | Human |
Mol.Wt.: | 32kD; 32kD(Calculated). |
Uniprot: | Q9H190 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
MDA9; Melanoma differentiation associated gene 9; Pro TGF alpha cytoplasmic domain interacting protein 18; SDCB2_HUMAN; SDCBP2; SITAC; SITAC18; ST 2; Syndecan binding protein (syntenin) 2; Syndecan binding protein 2; Syndecan-binding protein 2; Syntenin-2;
Immunogens
A synthesized peptide derived from Human Syntenin 2.
Preferentially expressed in cells of the digestive tract (PubMed:11102519). Low expression in skeletal muscle and kidney (PubMed:11102519). Detected in differentiated keratinocytes of normal and malignant epithelium (PubMed:22623796). In healthy skin, expression is localized in suprabasal epidermal layers (PubMed:22623796).
- Q9H190 SDCB2_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSSLYPSLEDLKVDQAIQAQVRASPKMPALPVQATAISPPPVLYPNLAELENYMGLSLSSQEVQESLLQIPEGDSTAVSGPGPGQMVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA
Research Backgrounds
Binds phosphatidylinositol 4,5-bisphosphate (PIP2). May play a role in the organization of nuclear PIP2, cell division and cell survival.
Cytoplasm. Nucleus>Nucleolus. Nucleus>Nucleoplasm. Cell membrane. Nucleus speckle.
Note: Associates with intracellular membranes and enriched in the apical region of the cell and in intracellular compartments (PubMed:11102519). Colocalizes with TM4SF1 in the apical region of the cell (PubMed:11102519). Predominantly targeted to nuclear PIP2 pools. Shuttles between several subcellular compartments (PubMed:15961997). PIP2 plays an important role in the distribution of SDCBP2 (PubMed:23300061).
Preferentially expressed in cells of the digestive tract. Low expression in skeletal muscle and kidney. Detected in differentiated keratinocytes of normal and malignant epithelium. In healthy skin, expression is localized in suprabasal epidermal layers.
Monomer and homodimer. Interacts with SDCBP. Interacts with TM4SF1.
Binds phosphatidylinositol 4,5-bisphosphate (PIP2) via its two PDZ domains. These domains target SDCBP2 to the plasma membranes and nucleoli, two PIP2-rich regions.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.