SLC39A5 Antibody - #DF14954
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
LZT Hs7; MGC34778; OTTHUMP00000211153; OTTHUMP00000211154; S39A5_HUMAN; SLC39A5; solute carrier family 39 (metal ion transporter), member 5; Solute carrier family 39 member 5; Zinc transporter ZIP5 [Precursor]; Zinc transporter ZIP5; ZIP 5; ZIP-5; ZIP5; Zrt and Irt like protein 5; Zrt- and Irt-like protein 5;
Immunogens
A synthesized peptide derived from human SLC39A5.
Expressed in liver, kidney, pancreas, small intestine, colon, spleen, fetal liver and fetal kidney.
- Q6ZMH5 S39A5_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MMGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDLEESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQFALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVLLLSLPSPLSLLLLRLLGPRLLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFVLENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQHPPALAPPGHQGHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGVTAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG
Research Backgrounds
May play a role in polarized cells by carrying out serosal-to-mucosal zinc transport. Plays a role in eye development. Could regulate the BMP/TGF-beta (bone morphogenetic protein/transforming growth factor-beta) signaling pathway and modulates extracellular matrix (ECM) proteins of the sclera. Seems to play a central role in controlling organismal zinc status (By similarity).
Glycosylated.
Basolateral cell membrane>Multi-pass membrane protein.
Expressed in liver, kidney, pancreas, small intestine, colon, spleen, fetal liver and fetal kidney.
Belongs to the ZIP transporter (TC 2.A.5) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.