TSPAN6 Antibody - #DF15805
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Fold/Unfold
6720473L21Rik; A15 homolog; AI316786; DKFZp469J2433; MGC117923; MGC133784; Putative NF kappa B activating protein 321; Putative NF-kappa-B-activating protein 321; T245; T245 protein; Tetraspan TM4SF; Tetraspanin 6; Tetraspanin TM4 D; Tetraspanin TM4-D; Tetraspanin TM4D; Tetraspanin-6; Tm4sf; TM4SF6; Transmembrane 4 superfamily member 6; TSN6_HUMAN; TSPAN 6; Tspan-6; TSPAN6; Tspan6 protein;
Immunogens
A synthesized peptide derived from human TSPAN6.
- O43657 TSN6_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MASPSRRLQTKPVITCFKSVLLIYTFIFWITGVILLAVGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVDKIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLEDCTPQRDADKVNNEGCFIKVMTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAITNNQYEIV
Research Backgrounds
Membrane>Multi-pass membrane protein.
Belongs to the tetraspanin (TM4SF) family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.