Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    Syntaxin 1A Antibody
  • Catalog No.
    AF6463
  • RRID
    AB_2835283
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Bovine, Sheep
  • UniProt
  • Mol.Wt
    35kD;
    33kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

HPC 1; Neuron specific antigen HPC1; Neuron-specific antigen HPC-1; OTTHUMP00000174615; OTTHUMP00000174616; OTTHUMP00000174617; OTTHUMP00000174618; P35-1; STX1; STX1A; STX1A_HUMAN; SYN1A; Syntaxin 1A (brain); Syntaxin 1A brain; Syntaxin-1A;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Bovine, Sheep

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

Syntaxin 1A Antibody detects endogenous levels of total Syntaxin 1A.

RRID:

AB_2835283
Please cite this product as: Affinity Biosciences Cat# AF6463, RRID:AB_2835283.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human Syntaxin 1A, corresponding to a region within N-terminal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

STX1A

Molecular Weight:

Observed Mol.Wt.: 35kD.
Predicted Mol.Wt.: 33kDa(Calculated)..

Subcellular Location:

Secreted and Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Cell junction > synapse > synaptosome.

Tissue Specificity:

Q16623 STX1A_HUMAN:
Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.

Description:

STX1A is a type IV membrane protein involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. Three splice variant isoforms have been described.

Sequence:
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA

Research Background

Function:

Plays an essential role in hormone and neurotransmitter calcium-dependent exocytosis and endocytosis. Part of the SNARE (Soluble NSF Attachment Receptor) complex composed of SNAP25, STX1A and VAMP2 which mediates the fusion of synaptic vesicles with the presynaptic plasma membrane. STX1A and SNAP25 are localized on the plasma membrane while VAMP2 resides in synaptic vesicles. The pairing of the three SNAREs from the N-terminal SNARE motifs to the C-terminal anchors leads to the formation of the SNARE complex, which brings membranes into close proximity and results in final fusion. Participates in the calcium-dependent regulation of acrosomal exocytosis in sperm. Plays also an important role in the exocytosis of hormones such as insulin or glucagon-like peptide 1 (GLP-1) (By similarity).

Post-translational Modifications:

Phosphorylated by CK2 (By similarity). Phosphorylation at Ser-188 by DAPK1 significantly decreases its interaction with STXBP1.

Sumoylated, sumoylation is required for regulation of synaptic vesicle endocytosis.

Subcellular Location:

Cytoplasmic vesicle>Secretory vesicle>Synaptic vesicle membrane>Single-pass type IV membrane protein. Cell junction>Synapse>Synaptosome. Cell membrane.
Note: Colocalizes with KCNB1 at the cell membrane.

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Isoform 1 is highly expressed in embryonic spinal chord and ganglia and in adult cerebellum and cerebral cortex. Isoform 2 is expressed in heart, liver, fat, skeletal muscle, kidney and brain.

Subunit Structure:

Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A; this complex constitutes the basic catalytic machinery of the complex neurotransmitter release apparatus. The SNARE complex interacts with CPLX1 (By similarity). Interacts with STXBP1. Interacts (via C-terminus) with KCNB1 (via C-terminus); the interaction increases in a calcium-dependent manner and induces a pore-independent enhancement of exocytosis in neuroendocrine cells, chromaffin cells, pancreatic beta cells and from the soma of dorsal root ganglia (DRG) neurons (By similarity). Interacts with SYTL4 (By similarity). Interacts with STXBP6 (By similarity). Interacts with PLCL1 (via C2 domain) (By similarity). Interacts with OTOF (By similarity). Interacts with LGI3 (By similarity). Interacts with SLC6A4 (By similarity). Interacts with SYT6 and SYT8; the interaction is Ca(2+)-dependent (By similarity). Interacts with VAMP8. Interacts with SNAP23. Interacts with VAPA and SYBU. Interacts with PRRT2 (By similarity). Interacts with SEPT8 (By similarity). Interacts with STXBP5L (By similarity). Interacts with synaptotagmin-1/SYT1 (By similarity).

Similarity:

Belongs to the syntaxin family.

Research Fields

Research Fields:

· Genetic Information Processing > Folding, sorting and degradation > SNARE interactions in vesicular transport.
· Human Diseases > Substance dependence > Amphetamine addiction.
· Organismal Systems > Nervous system > Synaptic vesicle cycle.
· Organismal Systems > Endocrine system > Insulin secretion.(View pathway)

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF6463-BP
(Blocking peptide available as AF6463-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Bovine
100%
Sheep
100%
Pig
0%
Horse
0%
Dog
0%
Xenopus
0%
Zebrafish
0%
Chicken
0%
Rabbit
0%
High similarity Medium similarity Low similarity No similarity
Q16623 as Substrate
Site PTM Type Enzyme
S14 Phosphorylation P68400 (CSNK2A1)
T23 Phosphorylation
S64 Phosphorylation
S99 Phosphorylation
C145 S-Nitrosylation
S188 Phosphorylation P53355 (DAPK1)
S249 Phosphorylation
S281 Phosphorylation
T282 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top