beta-Tubulin Antibody - Fluor488 - #T0023-488

(1)  
Product: beta-Tubulin Antibody - Fluor488
Catalog: T0023-488
Description: Mouse monoclonal antibody to beta-Tubulin - Fluor488
Application: IF/ICC FACS
Reactivity: Human, Mouse, Rat, Sheep, Rabbit, Dog, Monkey, Hamster, Chicken
Mol.Wt.: 55KD; 50kD(Calculated).
Uniprot: P07437

View similar products>>

   Size Price Inventory
 50ul $150 In stock
 100ul $250 In stock
 200ul $350 In stock
 1ml $1200 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Mouse
Application:
IF/ICC 1:100-1:200, FACS 1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat,Sheep,Rabbit,Dog,Monkey,Hamster,Chicken
Clonality:
Monoclonal
Specificity:
beta-Tubulin Mouse Monoclonal antibody detects endogenous levels of total beta-Tubulin protein.
Conjugate:
Fluor488. Ex:499nm/Em:520nm
Purification:
Affinity-chromatography.
Storage:
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl. Store at -20 °C. Stable for 12 months from date of receipt. Store In the Dark.
Alias:

Fold/Unfold

TUBB3, CDCBM, Beta III Tubulin, Class III beta-tubulin, TUBB4, Tubulin, beta 3, Tubulin beta-III, Tubulin beta-3 chain, Tubulin beta-4 chain, Tubulin, beta 3 class III, CFEOM3A

Immunogens

Immunogen:

Full-length beta-tubulin protein of human.

Uniprot:

P07437(TBB5_HUMAN) >>Visit HPA database.

Gene(ID):
TUBB(203068)
Expression:
P07437 TBB5_HUMAN:

Ubiquitously expressed with highest levels in spleen, thymus and immature brain.

Description:
Microtubules are constituent parts of the mitotic apparatus, cilia, flagella, and elements of the cytoskeleton. They consist principally of 2 soluble proteins, alpha- and beta-tubulin, each of about 55,000 kDa. Antibodies against beta Tubulin are useful as loading controls for Western Blotting. However it should be noted that levels of beta-Tubulin may not be stable in certain cells. For example, expression of beta-Tubulin in adipose tissue is very low and therefore beta-Tubulin should not be used as loading control for these tissues.
Sequence:
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAVTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEEAEEEA

Research Backgrounds

Function:

Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.

PTMs:

Some glutamate residues at the C-terminus are polyglutamylated, resulting in polyglutamate chains on the gamma-carboxyl group. Polyglutamylation plays a key role in microtubule severing by spastin (SPAST). SPAST preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity by SPAST increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold.

Some glutamate residues at the C-terminus are monoglycylated but not polyglycylated due to the absence of functional TTLL10 in human. Monoglycylation is mainly limited to tubulin incorporated into axonemes (cilia and flagella). Both polyglutamylation and monoglycylation can coexist on the same protein on adjacent residues, and lowering glycylation levels increases polyglutamylation, and reciprocally. The precise function of monoglycylation is still unclear (Probable).

Phosphorylated on Ser-172 by CDK1 during the cell cycle, from metaphase to telophase, but not in interphase. This phosphorylation inhibits tubulin incorporation into microtubules.

Subcellular Location:

Cytoplasm>Cytoskeleton.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Ubiquitously expressed with highest levels in spleen, thymus and immature brain.

Family&Domains:

The highly acidic C-terminal region may bind cations such as calcium.

Belongs to the tubulin family.

Research Fields

· Cellular Processes > Transport and catabolism > Phagosome.   (View pathway)

· Cellular Processes > Cellular community - eukaryotes > Gap junction.   (View pathway)

· Human Diseases > Infectious diseases: Bacterial > Pathogenic Escherichia coli infection.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.