CDKA1 / DOC1 Antibody - #AF0309
Product: | CDKA1 / DOC1 Antibody |
Catalog: | AF0309 |
Description: | Rabbit polyclonal antibody to CDKA1 / DOC1 |
Application: | WB IHC IF/ICC |
Reactivity: | Human, Mouse |
Mol.Wt.: | 20kDa; 12kD(Calculated). |
Uniprot: | O14519 |
RRID: | AB_2833473 |
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# AF0309, RRID:AB_2833473.
Fold/Unfold
CDK2 A1; CDK2 associated protein 1; CDK2-associated protein 1; CDK2AP1; CDKA1; CDKA1_HUMAN; Cyclin dependent kinase 2 associated protein 1; Cyclin-dependent kinase 2-associated protein 1; Deleted in oral cancer 1; DOC 1; DOC 1 related protein; DOC 1R; DOC-1; DOC1; DOC1R; DORC1; p12DOC 1; Putative oral cancer suppressor; ST19;
Immunogens
A synthesized peptide derived from human CDKA1 / DOC1, corresponding to a region within C-terminal amino acids.
- O14519 CDKA1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MSYKPNLAAHMPAAALNAAGSVHSPSTSMATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS
Research Backgrounds
specific inhibitor of the cell-cycle kinase CDK2.
Phosphorylated in vitro by IKBKE at Ser-46.
Belongs to the CDK2AP family.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.