MELK Antibody - #DF3278

(1)   (3)  
Product: MELK Antibody
Catalog: DF3278
Description: Rabbit polyclonal antibody to MELK
Application: WB IF/ICC
Reactivity: Human
Mol.Wt.: 75 KD; 75kD(Calculated).
Uniprot: Q14680
RRID: AB_2835646

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors
Related Downloads
MS Report
HPLC Report
MSDS
Data Sheet
COA
Protocols
WB Handbook
IHC Protocol
IF/ICC Protocol

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
MELK Antibody detects endogenous levels of total MELK.
RRID:
AB_2835646
Cite Format: Affinity Biosciences Cat# DF3278, RRID:AB_2835646.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

AI327312; hMELK; HPK 38; hPK38; KIAA0175; Likely ortholog of maternal embryonic leucine zipper kinase; Maternal embryonic leucine zipper kinase; MELK; MELK_HUMAN; mKIAA0175; MPK38; OTTHUMP00000021377; OTTHUMP00000046113; pEg3 kinase; Protein kinase Eg3; Protein kinase PK38; RP23 382O11.1; Tyrosine protein kinase MELK;

Immunogens

Immunogen:
Uniprot:

Q14680(MELK_HUMAN) >>Visit HPA database.

Gene(ID):
MELK(9833)
Expression:
Q14680 MELK_HUMAN:

Expressed in placenta, kidney, thymus, testis, ovary and intestine.

Sequence:
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV

PTMs - Q14680 As Substrate

Site PTM Type Enzyme
K2 Ubiquitination
Y4 Phosphorylation
K9 Ubiquitination
K24 Ubiquitination
K44 Ubiquitination
S49 Phosphorylation
K55 Sumoylation
K55 Ubiquitination
T56 Phosphorylation Q14680 (MELK)
K62 Ubiquitination
K134 Ubiquitination
K145 Ubiquitination
K147 Ubiquitination
K156 Ubiquitination
K161 Ubiquitination
Y163 Phosphorylation Q14680 (MELK)
T167 Phosphorylation Q15831 (STK11) , Q14680 (MELK)
S171 Phosphorylation Q14680 (MELK)
K225 Ubiquitination
Y226 Phosphorylation
S236 Phosphorylation
S253 Phosphorylation Q14680 (MELK)
K255 Ubiquitination
Y267 Phosphorylation
Y269 Phosphorylation
S335 Phosphorylation
S336 Phosphorylation Q14680 (MELK)
S338 Phosphorylation
S343 Phosphorylation Q14680 (MELK)
T345 Phosphorylation
T348 Phosphorylation
S356 Phosphorylation Q14680 (MELK)
S363 Phosphorylation
Y367 Phosphorylation Q14680 (MELK)
T387 Phosphorylation Q14680 (MELK)
S391 Phosphorylation Q14680 (MELK)
K395 Ubiquitination
T398 Phosphorylation Q14680 (MELK)
S400 Phosphorylation
S405 Phosphorylation Q14680 (MELK)
K406 Sumoylation
K406 Ubiquitination
S407 Phosphorylation Q14680 (MELK)
T409 Phosphorylation Q14680 (MELK)
T415 Phosphorylation
K423 Ubiquitination
Y427 Phosphorylation
T428 Phosphorylation
S431 Phosphorylation Q14680 (MELK)
K434 Sumoylation
K434 Ubiquitination
Y438 Phosphorylation Q14680 (MELK)
T446 Phosphorylation
T459 Phosphorylation
T460 Phosphorylation
R463 Methylation
T466 Phosphorylation
S468 Phosphorylation
K469 Ubiquitination
K476 Ubiquitination
T478 Phosphorylation
K481 Ubiquitination
S486 Phosphorylation
T489 Phosphorylation
K491 Ubiquitination
T494 Phosphorylation Q14680 (MELK)
S498 Phosphorylation
S505 Phosphorylation Q14680 (MELK)
T518 Phosphorylation
K520 Ubiquitination
K525 Sumoylation
K525 Ubiquitination
S529 Phosphorylation Q14680 (MELK)
K536 Ubiquitination
T539 Phosphorylation Q14680 (MELK)
T542 Phosphorylation
S544 Phosphorylation
K558 Ubiquitination
K585 Ubiquitination
K592 Ubiquitination
K597 Ubiquitination
K632 Ubiquitination
K639 Methylation
K639 Ubiquitination
K650 Methylation
K650 Ubiquitination

PTMs - Q14680 As Enzyme

Substrate Site Source
O15105 (SMAD7) T96 Uniprot
O15530 (PDPK1) T354 Uniprot
P04637 (TP53) S15 Uniprot
P23588 (EIF4B) S406 Uniprot
P30305 (CDC25B) S169 Uniprot
P30305 (CDC25B) S219 Uniprot
P30305-3 (CDC25B) S280 Uniprot
P30305-2 (CDC25B) S307 Uniprot
P30305-1 (CDC25B) S321 Uniprot
P30305 (CDC25B) S323 Uniprot
P84022 (SMAD3) S204 Uniprot
Q13485 (SMAD4) S343 Uniprot
Q14680 (MELK) T56 Uniprot
Q14680 (MELK) Y163 Uniprot
Q14680 (MELK) T167 Uniprot
Q14680 (MELK) S171 Uniprot
Q14680 (MELK) S253 Uniprot
Q14680 (MELK) S336 Uniprot
Q14680 (MELK) S343 Uniprot
Q14680 (MELK) S356 Uniprot
Q14680 (MELK) Y367 Uniprot
Q14680 (MELK) T387 Uniprot
Q14680 (MELK) S391 Uniprot
Q14680 (MELK) T398 Uniprot
Q14680 (MELK) S405 Uniprot
Q14680 (MELK) S407 Uniprot
Q14680 (MELK) T409 Uniprot
Q14680 (MELK) S431 Uniprot
Q14680 (MELK) Y438 Uniprot
Q14680 (MELK) T494 Uniprot
Q14680 (MELK) S505 Uniprot
Q14680 (MELK) S529 Uniprot
Q14680 (MELK) T539 Uniprot
Q15796 (SMAD2) S245 Uniprot
Q99683 (MAP3K5) T838 Uniprot

Research Backgrounds

Function:

Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. Plays a key role in cell proliferation and carcinogenesis. Required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14, possibly leading to affect mammary carcinogenesis by mediating inhibition of the pro-apoptotic function of BCL2L14. Also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus. May also play a role in primitive hematopoiesis.

PTMs:

Autophosphorylated: autophosphorylation of the T-loop at Thr-167 and Ser-171 is required for activation. Thr-478 phosphorylation during mitosis promotes interaction with PPP1R8 (Probable).

Subcellular Location:

Cell membrane>Peripheral membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed in placenta, kidney, thymus, testis, ovary and intestine.

Subunit Structure:

Monomer. Interacts with ZNF622 and PPP1R8.

Family&Domains:

The KA1 domain mediates binding to phospholipids and targeting to membranes.

Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. SNF1 subfamily.

References

1). Sharp Downregulation of Hub Genes Associated With the Pathogenesis of Breast Cancer From Ductal Carcinoma In Situ to Invasive Ductal Carcinoma. Frontiers in Oncology (PubMed: 34094915) [IF=4.7]

Application: WB    Species: Human    Sample: breast cancer tissue

Figure 6 Protein expression levels of hub genes. (A) Protein expression levels of CDK1, MELK, CEP55, TOP2A, NUSAP1, PBK, RRM2, and MAD2L1 were determined by western blotting. (B) Western blot analysis of CDK1, MELK, CEP55, TOP2A, NUSAP1, PBK, RRM2, and MAD2L1 in tissue from different stages of breast disease, and quantification of the intensity relative to GAPDH. One-way ANOVA was performed to acquire statistical significance (*p < 0.05, **p < 0.01, ***p < 0.001, ****p < 0.0001). NME, normal mammary epithelium; SH, simple ductal hyperplasia; ADH, atypical ductal hyperplasia; DCIS, ductal carcinoma in situ; IDC, invasive ductal carcinoma.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.