Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    NT5C3 Antibody
  • Catalog No.
    DF3430
  • RRID
    AB_2835730
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA(peptide)
  • Reactivity
    Human, Mouse
  • Prediction
    Pig, Horse, Sheep
  • UniProt
  • Mol.Wt
    38 kD;
    38kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

5NT3A_HUMAN; cN III; cN-III; cNIII; Cytosolic 5' nucleotidase 3; Cytosolic 5' nucleotidase III; Cytosolic 5''-nucleotidase 3; Cytosolic 5''-nucleotidase 3A; Cytosolic 5''-nucleotidase III; Nt5c3a; p36; P5''N-1; P5'N 1; P5'N1; P5N 1; P5N-1; P5N1; PN I; PN-I; PNI; PSN1; Pyrimidine 5' nucleotidase 1; Pyrimidine 5''-nucleotidase 1; UMPH; UMPH1; Uridine 5' monophosphate hydrolase 1; Uridine 5''-monophosphate hydrolase 1;

Applications:

WB 1:500-1:1000, IHC: 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse

Predicted Reactivity:

Pig, Horse, Sheep

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

NT5C3 Antibody detects endogenous levels of total NT5C3.

RRID:

AB_2835730
Please cite this product as: Affinity Biosciences Cat# DF3430, RRID:AB_2835730.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human NT5C3, corresponding to a region within N-terminal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

NT5C3A

Molecular Weight:

Observed Mol.Wt.: 38 kD.
Predicted Mol.Wt.: 38kDa(Calculated)..

Subcellular Location:

Cytoplasm and Endoplasmic reticulum.

Tissue Specificity:

Q9H0P0 5NT3A_HUMAN:
Isoforms 1, 3 and 4 are expressed in reticulocytes. Isoform 4 is hardly detectable in bone marrow and fetal liver.

Sequence:
MRAPSMDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

Research Background

Function:

Nucleotidase which shows specific activity towards cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m(7)GMP). CMP seems to be the preferred substrate.

Subcellular Location:

Cytoplasm.

Endoplasmic reticulum.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Isoforms 1, 3 and 4 are expressed in reticulocytes. Isoform 4 is hardly detectable in bone marrow and fetal liver.

Subunit Structure:

Monomer.

Similarity:

Belongs to the pyrimidine 5'-nucleotidase family.

Research Fields

Research Fields:

· Metabolism > Nucleotide metabolism > Purine metabolism.
· Metabolism > Nucleotide metabolism > Pyrimidine metabolism.
· Metabolism > Metabolism of cofactors and vitamins > Nicotinate and nicotinamide metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF3430-BP
(Blocking peptide available as DF3430-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Horse
100%
Sheep
100%
Pig
88%
Chicken
75%
Bovine
0%
Dog
0%
Xenopus
0%
Zebrafish
0%
Rabbit
0%
High similarity Medium similarity Low similarity No similarity
Q9H0P0 as Substrate
Site PTM Type Enzyme
K47 Ubiquitination
K57 Ubiquitination
K77 Ubiquitination
K128 Ubiquitination
K130 Ubiquitination
K167 Ubiquitination
K225 Ubiquitination
S228 Phosphorylation
T236 Phosphorylation
K243 Ubiquitination
K252 Ubiquitination
T260 Phosphorylation
K267 Ubiquitination
S278 Phosphorylation
K296 Ubiquitination
R303 Methylation
K334 Ubiquitination
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top