Dual specificity phosphatase 19; Dual specificity phosphatase TS DSP1; Dual specificity phosphatase TS-DSP1; Dual specificity protein phosphatase 19; DUS19_HUMAN; DUSP 17; DUSP 19; DUSP17; Dusp19; LMW DSP3; LMW-DSP3; LMWDSP 3; LMWDSP3; Low molecular weight dual specificity phosphatase 3; MGC138210; Protein phosphatase SKRP1; SAPK pathway regulating phosphatase 1; SAPK pathway-regulating phosphatase 1; SKRP 1; SKRP1; Stress activated protein kinase pathway regulating phosphatase 1; Stress-activated protein kinase pathway-regulating phosphatase 1; TS DSP1;
WB 1:500-1:1000, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Human
Bovine(91%), Sheep(82%), Rabbit(91%), Dog(82%)
Rabbit
Polyclonal
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
DUSP19 Antibody detects endogenous levels of total DUSP19.
AB_2835753
Please cite this product as: Affinity Biosciences Cat# DF3371, RRID:AB_2835753.
Liquid
1mg/ml
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.
A synthesized peptide derived from human DUSP19, corresponding to a region within the internal amino acids.
>>Visit The Human Protein Atlas
DUSP19
Observed Mol.Wt.: 28kD.
Predicted Mol.Wt.: 24kDa(Calculated)..
Q8WTR2 DUS19_HUMAN:
Expressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest.
MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
Has a dual specificity toward Ser/Thr and Tyr-containing proteins.
Expressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest.
Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
DF3371-BP
(Blocking peptide available as DF3371-BP)
$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).
Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.
Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Site | PTM Type | Enzyme | Source |
---|---|---|---|
M1 | Acetylation | Uniprot | |
Y2 | Phosphorylation | Uniprot | |
T24 | Phosphorylation | Uniprot | |
T27 | Phosphorylation | Uniprot |