Price Size
$280 100ul
$350 200ul

Same day delivery

Contact distributor
  • Product Name
    DUSP19 Antibody
  • Catalog No.
    DF3371
  • RRID
    AB_2835753
  • Source
    Rabbit
  • Application
    WB,IF/ICC,ELISA
  • Reactivity
    Human
  • Prediction
    Bovine(91%), Sheep(82%), Rabbit(91%), Dog(82%)
  • UniProt
  • Mol.Wt
    28kD;
    24kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

Dual specificity phosphatase 19; Dual specificity phosphatase TS DSP1; Dual specificity phosphatase TS-DSP1; Dual specificity protein phosphatase 19; DUS19_HUMAN; DUSP 17; DUSP 19; DUSP17; Dusp19; LMW DSP3; LMW-DSP3; LMWDSP 3; LMWDSP3; Low molecular weight dual specificity phosphatase 3; MGC138210; Protein phosphatase SKRP1; SAPK pathway regulating phosphatase 1; SAPK pathway-regulating phosphatase 1; SKRP 1; SKRP1; Stress activated protein kinase pathway regulating phosphatase 1; Stress-activated protein kinase pathway-regulating phosphatase 1; TS DSP1;

Applications:

WB 1:500-1:1000, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human

Predicted Reactivity:

Bovine(91%), Sheep(82%), Rabbit(91%), Dog(82%)

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

DUSP19 Antibody detects endogenous levels of total DUSP19.

RRID:

AB_2835753
Please cite this product as: Affinity Biosciences Cat# DF3371, RRID:AB_2835753.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information

Immunogen:

A synthesized peptide derived from human DUSP19, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

DUSP19

Molecular Weight:

Observed Mol.Wt.: 28kD.
Predicted Mol.Wt.: 24kDa(Calculated)..

Tissue Specificity:

Q8WTR2 DUS19_HUMAN:
Expressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest.

Sequence:
MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS

Research Background

Function:

Has a dual specificity toward Ser/Thr and Tyr-containing proteins.

Tissue Specificity:

Expressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest.

Similarity:

Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF3371-BP
(Blocking peptide available as DF3371-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Rabbit
91%
Bovine
91%
Sheep
82%
Dog
82%
Horse
73%
Chicken
73%
Pig
64%
Xenopus
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
Q8WTR2 as Substrate
Site PTM Type Enzyme
M1 Acetylation
Y2 Phosphorylation
T24 Phosphorylation
T27 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top