Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    BST1 Antibody
  • Catalog No.
    DF3744
  • RRID
    AB_2836108
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig, Bovine, Rabbit, Dog, Chicken
  • UniProt
  • Mol.Wt
    34 kD;
    36kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

ADP ribosyl cyclase 2; ADP-ribosyl cyclase 2; ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2; Bone marrow stromal antigen 1; Bone marrow stromal cell antigen 1; BST 1; BST-1; BST1; BST1_HUMAN; cADPr hydrolase 2; CD157; CD157 antigen; Cyclic ADP ribose hydrolase 2; Cyclic ADP-ribose hydrolase 2; NAD(+) nucleosidase; OTTHUMP00000217617;

Applications:

WB 1:500-1:1000, IF/ICC 1:100-1:500, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig, Bovine, Rabbit, Dog, Chicken

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

BST1 Antibody detects endogenous levels of total BST1.

RRID:

AB_2836108
Please cite this product as: Affinity Biosciences Cat# DF3744, RRID:AB_2836108.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human BST1, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

BST1

Molecular Weight:

Observed Mol.Wt.: 34 kD.
Predicted Mol.Wt.: 36kDa(Calculated)..

Subcellular Location:

Cell membrane.

Tissue Specificity:

Q10588 BST1_HUMAN:
Widely expressed.

Sequence:
MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL

Research Background

Function:

Synthesizes the second messengers cyclic ADP-ribose and nicotinate-adenine dinucleotide phosphate, the former a second messenger that elicits calcium release from intracellular stores. May be involved in pre-B-cell growth.

Subcellular Location:

Cell membrane>Lipid-anchor.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Widely expressed.

Subunit Structure:

Homodimer.

Similarity:

Belongs to the ADP-ribosyl cyclase family.

Research Fields

Research Fields:

· Metabolism > Metabolism of cofactors and vitamins > Nicotinate and nicotinamide metabolism.
· Metabolism > Global and overview maps > Metabolic pathways.
· Organismal Systems > Digestive system > Salivary secretion.
· Organismal Systems > Digestive system > Pancreatic secretion.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF3744-BP
(Blocking peptide available as DF3744-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Bovine
100%
Dog
90%
Chicken
80%
Rabbit
80%
Xenopus
70%
Horse
0%
Sheep
0%
Zebrafish
0%
High similarity Medium similarity Low similarity No similarity
Q10588 as Substrate
Site PTM Type Enzyme
N95 N-Glycosylation
N192 N-Glycosylation
Y263 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top