CTDSP1 Antibody - #DF3902
| Product: | CTDSP1 Antibody |
| Catalog: | DF3902 |
| Description: | Rabbit polyclonal antibody to CTDSP1 |
| Application: | WB IHC IF/ICC |
| Reactivity: | Human, Mouse, Rat |
| Prediction: | Pig, Bovine, Sheep, Rabbit |
| Mol.Wt.: | 30 KD; 29kD(Calculated). |
| Uniprot: | Q9GZU7 |
| RRID: | AB_2836255 |
Related Downloads
Protocols
Product Info
*The optimal dilutions should be determined by the end user.
*Tips:
WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.
Cite Format: Affinity Biosciences Cat# DF3902, RRID:AB_2836255.
Fold/Unfold
Carboxy terminal domain RNA polymerase II polypeptide A small phosphatase 1; Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; CTD (carboxy terminal domain RNA polymerase II polypeptide A) small phosphatase 1; CTDS1_HUMAN; CTDSP1; NIF3; NLI IF; NLI interacting factor 3; NLI-IF; NLI-interacting factor 3; NLIIF; Nuclear LIM interactor interacting factor 3; Nuclear LIM interactor-interacting factor 3; SCP1; Small C-terminal domain phosphatase 1; Small CTD phosphatase 1;
Immunogens
Expression is restricted to non-neuronal tissues. Highest expression in skeletal muscle, spleen, lung and placenta.
- Q9GZU7 CTDS1_HUMAN:
- Protein BLAST With
- NCBI/
- ExPASy/
- Uniprot
MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS
Predictions
Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.
High(score>80) Medium(80>score>50) Low(score<50) No confidence
PTMs - Q9GZU7 As Substrate
| Site | PTM Type | Enzyme | Source |
|---|---|---|---|
| M1 | Acetylation | Uniprot | |
| K22 | Acetylation | Uniprot | |
| K26 | Acetylation | Uniprot | |
| K32 | Ubiquitination | Uniprot | |
| T74 | Phosphorylation | Uniprot | |
| K84 | Ubiquitination | Uniprot | |
| S180 | Phosphorylation | Uniprot | |
| Y188 | Phosphorylation | Uniprot | |
| S245 | Phosphorylation | Uniprot | |
| Y251 | Phosphorylation | Uniprot | |
| S252 | Phosphorylation | Uniprot |
Research Backgrounds
Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.
Nucleus.
Note: Colocalizes with RNA polymerase II.
Expression is restricted to non-neuronal tissues. Highest expression in skeletal muscle, spleen, lung and placenta.
Monomer (By similarity). Interacts with GTF2F1. Interacts with REST.
Restrictive clause
Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.
For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.