Product: CLM-1 Antibody
Catalog: DF4813
Description: Rabbit polyclonal antibody to CLM-1
Application: WB IF/ICC
Reactivity: Human
Mol.Wt.: 30 KD; 32kD(Calculated).
Uniprot: Q8TDQ1
RRID: AB_2837164

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:1000, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human
Clonality:
Polyclonal
Specificity:
CLM-1 Antibody detects endogenous levels of total CLM-1.
RRID:
AB_2837164
Cite Format: Affinity Biosciences Cat# DF4813, RRID:AB_2837164.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD300 antigen like family member; CD300 antigen-like family member F; CD300 molecule like family member f; CD300f; CD300LF; CLM; CLM-1; CLM1; CLM1_HUMAN; CMRF35-like molecule 1; IGSF; IgSF13; Immune receptor expressed on myeloid cells 1; immune receptor expressed on myeloid cells; immunoglobin superfamily member; Immunoglobulin superfamily member 13; Immunoglobulin superfamily member; Inhibitory receptor IREM1; IREM; IREM-1; IREM1; Nepmucin; NK inhibitory receptor; NKIR; TREM; triggering receptors expressed on myeloid cells; UNQ3105/PRO10111;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
Q8TDQ1 CLM1_HUMAN:

Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells.

Sequence:
MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRMMKYQQKAAGMSPEQVLQPLEGDLCYADLTLQLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEEPTEYSTISRP

PTMs - Q8TDQ1 As Substrate

Site PTM Type Enzyme
K76 Acetylation
Y205 Phosphorylation
Y236 Phosphorylation P06241 (FYN)
Y249 Phosphorylation
Y263 Phosphorylation P06241 (FYN)
Y284 Phosphorylation

Research Backgrounds

Function:

Acts as an inhibitory receptor for myeloid cells and mast cells. Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells. Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis (By similarity). Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide and sphingomyelin which act as ligands. May act as a coreceptor for interleukin 4 (IL-4). Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling (By similarity). Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2. Inhibits osteoclast formation. Induces macrophage cell death upon engagement (By similarity).

PTMs:

Phosphorylated on tyrosine.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Highly expressed in spleen, peripheral blood leukocyte and monocyte, and lung. Weakly expressed in thymus, heart, brain, placenta, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine or colon. Expressed selectively in monocytes and monocyte-related cells.

Subunit Structure:

Interacts with PTPN6/SHP-1 in a tyrosine phosphorylation dependent manner. Interacts with IL4R (By similarity).

Family&Domains:

Belongs to the CD300 family.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.