12-(S)-HETE acid receptor; 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (HETE) receptor; 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor; 12-(S)-HYDROXYEICOSATETRAENOIC ACID RECEPTOR; 12-HETER; bA517H2.2 (G protein coupled receptor 31); G protein coupled receptor 31; GPR31; HETER; HETER1; OTTHUMP00000017616; Probable G protein coupled receptor 31;
WB 1:500-1:1000, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Human
Pig(85%), Bovine(85%), Horse(85%), Dog(85%)
Rabbit
Polyclonal
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
GPR31 Antibody detects endogenous levels of total GPR31.
AB_2837323
Please cite this product as: Affinity Biosciences Cat# DF4970, RRID:AB_2837323.
Liquid
1mg/ml
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.
A synthesized peptide derived from human GPR31, corresponding to a region within the internal amino acids.
>>Visit The Human Protein Atlas
GPR31
Observed Mol.Wt.: 33kD.
Predicted Mol.Wt.: 35kDa(Calculated)..
Cell membrane; Multi pass membrane protein
MPFPNCSAPSTVVATAVGVLLGLECGLGLLGNAVALWTFLFRVRVWKPYAVYLLNLALADLLLAACLPFLAAFYLSLQAWHLGRVGCWALHFLLDLSRSVGMAFLAAVALDRYLRVVHPRLKVNLLSPQAALGVSGLVWLLMVALTCPGLLISEAAQNSTRCHSFYSRADGSFSIIWQEALSCLQFVLPFGLIVFCNAGIIRALQKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSCRALCAVAHTSDVTGSLTYLHSVLNPVVYCFSSPTFRSSYRRVFHTLRGKGQAAEPPDFNPRDSYS
High-affinity receptor for 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (12-S-HETE). 12-(S)-HETE is an arachidonic acid metabolite secreted by platelets and tumor cells, and known to induce endothelial cells retraction allowing invasive cell access to the subendothelial matrix, which is a critical step for extravasation or metastasis. Ligand-binding lead to activation of ERK1/2 (MAPK3/MAPK1), MEK, and NF-kappa-B.
Cell membrane>Multi-pass membrane protein.
Belongs to the G-protein coupled receptor 1 family.
DF4970-BP
(Blocking peptide available as DF4970-BP)
$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).
Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.
Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.
This product is for research use only. Not for use in diagnostic or therapeutic procedures.