IL1 beta Antibody | Affinity Biosciences

WB
IHC
IF/ICC
Cites

1/123

Western blot analysis of Interleukin 1β expression in HUVEC lysates.

WB analysis demonstrates levels of IL1-beta in rat brain.

Western blot analysis of extracts from A549 cells, using IL1 beta Antibody.

AF5103 at 1/100 staining rat endometrial tissue by IHC-P.

AF5103 at 1/100 staining Rat thymus tissue by IHC-P.

AF5103 at 1/100 staining Human mammary cancer by IHC-P.

AF5103 staining murine bone marrow-derived macrophages by ICC/IF.

$Fig. 7 a Western blot analysis demonstrates levels of TNF-a and IL-1b in the hippocampus of rats at 12, 24, and 48 h following TBI or sham operation (n = 5/group). b Densitometry of the TNF-a and IL-1b band correlated to the b-actin band. The bars represent the mean ± SE (n = 5/group). The results demonstrated that a significant increase of TNF-a and IL-1b expression in the TBI group (*p\0.01 vs. sham group), and treatment with TAK-242 significantly downregulated the level of TNF-a and IL-1b protein expression at 12, 24, and 48 h following TBI (# p\0.05 vs. TBI group). TNF-a, tumor necrosis factor-a; IL-1b, interleukin-1b$

Fig.

Figure 4 Neferine attenuates NLRP3/caspase-1/IL-1β activation in neonatal rat brain tissue after HI.

Fig.

FIGURE 7 Zinc can reduce the inflammation of damaged parts by inhibiting ferroptosis.

Fig.

FIGURE 6| (a) Immunohistochemical evaluation of vascular endothelial growth factor (VEGF),TNF-a, IL-6, and IL-1b in Zone 2 of the two groups, observed under original magnification 400.

FIGURE 7 |Total flavonoids from sea buckthorn fruit (TFSB) treatment suppressed the expression of cytokines, chemokines, and MUC5AC in bronchial tissues in lipopolysaccharide/cigarette smoke extract (LPS/CS)‐exposed mice.

Fig.

Figure 5: |Western blot image of pituitary gland protein expressions in rats.

Fig.

Figure 7.

Figure 4.

FIGURE 2|Byakangelicin alleviates liver injury in a carbon tetrachloride-induced model.

Fig.

Figure 3.

Fig.

FIGURE 3 Influence of AMC administration on diet-induced intestinal inflammation.

FIGURE 5 (A and B) The serum 1, 3-𝜷-D-glucan and IL-1𝜷 levels of ALD mice after paeonol treatment (n = 15).

FIGURE 6 Observe the F4/80 and IL-1𝜷 changes of mice liver tissue by IF assays (×400 magnification).

Fig.

Figure 2 p38MAPK signal pathway-related protein expression in the rat kidney of each group was detected by immunohistochemical staining.

Fig.

Figure 2 BA attenuates pyroptosis after SCI.

Fig.

Figure 3 The expression of IL-6, IL-8, IL-1β, and TNF-α mRNA and protein in the endometriotic tissue of different groups.

FIGURE 2 Phenotypic characteristics of macrophages in EtOH-fed mice liver tissue and ethanol-stimulated RAW264.

Figure 4 Effects of Rg1 on the expression levels of NLRP1, cleaved-caspase-1, IL-1β, NF-κB and p-NF-κB in LPS-induced HT22 cells determined by western blotting.

FIGURE 7 Effect of DHB on NLRP3 inflammasome signaling in pO/HX-induced hyperuricemic mice.

Fig.

FIGURE 8 Western blot analysis of NLRP3 inflammasome cascade in thyroid (A) Western blotting images of IL-17, p-NF-κB, NF-κB, NLRP3, ASC, cleaved-Caspase1, pro-Caspase 1, pro-IL-1β, cleaved-IL-1β, and IL-18: Lane 1, control group; lane 2, model group; lane 3, YH 5 g crude drug/kG group; lane 4, YH 15 g crude drug/kG group; lane 5, selenious group.

Fig.

Figure 5 ORY attenuated HMGB1/NLRP3 inflammasome during HIRI.

Figure 4:| TT inhibited the inflammatory activation of microglia and astrocytes.

FIGURE 1 |Effects of combined administration of RvE1 and LXA4 on pro-inflammatory factor expression.

FIGURE s4 |The total proteins of infected primary peritoneal macrophages were extracted at 24, 36, 48, and 72 h post-infection and then subjected for Western blotting.

Figure 4.

Figure 2 LPS induces pyroptosis by increasing intracellular reactive oxygen species levels and activating NLRP3 inflammasome.

FIGURE 6 Immunohistochemistry, Western blot and ELISA results of NLRP3 inflammasome in rats.

FIGURE 4 Melatonin decreased the expression of the NLRP3 inflammasome‐related proteins, IL‐1β, and activated the Sirt1 signaling pathway in the EAP model.

Fig.

Figure 4 Effects of Y-1 and Y-2 on NRK-52e cells’ inflammatory cytokines stimulated by sodium oleate with/without CD36 silences representative.

Fig.

Figure 7 Genetic expression of macrophage-related molecules, proinflammatory cytokines, and anti-inflammatory cytokines.

Figure 2 ROSI decreased renal tubular injury, cell apoptosis, and proinflammatory response in the mouse model.

Fig.

FIGURE 3 FA reduced the expression of pro-inflammatory mediators in astrocytes and microglia in the PIA model.

Fig.

FIGURE 5 QL suppresses IL-1β, NF-κB, and TNF-α expression.

Figure 5 Effects of PAL and Col (1 µM) on NF-κB/NLRP3 and Nrf2 signaling pathways in LPS plus MSU-activated THP-1 cells.

Figure 4 Calcitriol inhibited MI-induced cardiac myocyte apoptosis and death, as well as inflammation by modulating VDR signaling.

Figure 2 Effects of Rut on the expression of cyclooxygenase-2 (COX-2), interleukin-1 beta (IL-1β), and inducible nitric oxide synthase (iNOS) in LTA-stimulated RAW cells.

Figure 5 Notopterol attenuates the pro-inflammatory factors in the lungs of PAH rats.

Figure 9 Effects of MSCs treatment on the expression of cytokines in the hippocampus.

FIGURE 10 Effect of TTWC on the Level of NLRP3, ASC, pro-caspase-1, caspase-1, pro-IL-1beta, IL-1beta, pro-IL-18 and IL-18 protein in the prefrontal cortex (B1-B8) (Mean ± SD, n = 3).

Figure 6 Tuina treatment influenced the expression of pyroptosis-related molecules in the hippocampi of HIE rats.

Figure 4 Quercetin alleviated ethanol-induced pyroptosis via the nuclear transfer of PGC1α.

Figure 1 AOPPs accumulate in IVDD, up-regulate the expression of NOX4, senescence markers, and their associated inflammatory proteins, and accelerate IVDD.

Figure 7 Blocking NOX4 expression in vivo by AAV delays IVDD.

Fig.

Figure 7 XFZYD inhibited the IKBα/NF-κB signaling in rat models with CPB-induced ALI.

Figure 2 Elevated expression of molecules in TMJ synovium.

Fig.

Figure 4.

Fig.

Figure 2 Amelioration of lipid accumulation in PA-induced HepG2 cells by FV.

Fig.

Figure 7 (A) Immunohistochemistry images of IL-1β, IL-6 and TNF-α.

Figure 1 Fig.

Figure 2 CVB-D inhibits cellular iron-overload induced by LPS.

Fig.

FIGURE 7 (A) Magnification after immunohistochemical staining with different pro‐inflammatory cytokines on day 7.

FIGURE 5 Modified Linggui Zhugan Decoction (MLZD) inhibits the expression of inflammatory proteins.

Figure 2 NLRP3 inflammasome participates in argon-mediated microglia/macrophage polarization in vivo.

Figure 2 Effects of cholesterol on the inflammatory response and the expression of endoplasmic reticulum-related molecules in beta-TC-6 cells.

Figure 2 RvD1 treatment inhibits the activation of the NLRP3 inflammasome.

Fig.

expression in lung cancer.

Fig.

Figure 5 The IL-6/STAT3 signaling pathways were activated in CAG gastric tissue.

Figure 10.

Figure 4 LHQK suppressed caspase‐11 and caspase‐1‐dependent pyroptosis induced by LPS.

Fig.

Product:	IL1 beta Antibody
Catalog:	AF5103
Description:	Rabbit polyclonal antibody to IL1 beta
Application:	WB IHC IF/ICC
Reactivity:	Human, Mouse, Rat
Prediction:	Horse, Rabbit
Mol.Wt.:	30 kDa(precursor),17KD(mature); 31kD(Calculated).
Uniprot:	P01584
RRID:	AB_2837589

View similar products>>

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific.

Size	Price	Inventory
100ul	$280	In stock
200ul	$350	In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Source:

Rabbit

Application:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:

Human,Mouse,Rat

Prediction:

Horse(80%), Rabbit(100%)

Clonality:

Polyclonal

Specificity:

IL1 beta Antibody detects endogenous levels of total IL1 beta.

RRID:

AB_2837589
Cite Format: Affinity Biosciences Cat# AF5103, RRID:AB_2837589.

Conjugate:

Unconjugated.

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Storage:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.

Alias:

Fold/Unfold

Catabolin; H1; IL 1; IL 1 beta; IL-1 beta; IL1 BETA; IL1B; IL1B_HUMAN; IL1F2; Interleukin 1 beta; Interleukin-1 beta; OAF; OTTHUMP00000162031; Preinterleukin 1 beta; Pro interleukin 1 beta;

Immunogens

Immunogen:

Uniprot:

P01584(IL1B_HUMAN) >>Visit HPA database.

Gene(ID):

IL1B(3553)

Expression:

P01584 IL1B_HUMAN:

Expressed in activated monocytes/macrophages (at protein level).

Description:

IL-1 production is generally thought to be associated with inflammation, but it has also been shown to be expressed during kidney development, thymocyte differentiation and cartilage degradation. IL-1 plays a critical role in the regulation of immune response and inflammation, acting as an activator of T and B lymphocytes and natural killer (NK) cells.

Sequence:

P01584 IL1B_HUMAN:
Protein BLAST With
NCBI/
ExPASy/
Uniprot

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species

Results

Score

Rabbit

100

Horse

Pig

Dog

Bovine

Sheep

Xenopus

Zebrafish

Chicken

Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P01584 As Substrate

P01584

Site	PTM Type	Source
Y140	Phosphorylation	Uniprot
S200	Phosphorylation	Uniprot
S269	Phosphorylation	Uniprot

Research Backgrounds

P01584_IL1B_HUMAN

Function:

Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells.

PTMs:

Activation of the IL1B precursor involves a CASP1-catalyzed proteolytic cleavage. Processing and secretion are temporarily associated.

Subcellular Location:

Cytoplasm>Cytosol. Lysosome. Secreted>Extracellular exosome. Secreted.
Note: The precursor is cytosolic. In response to inflammasome-activating signals, such as ATP for NLRP3 inflammasome or bacterial flagellin for NLRC4 inflammasome, cleaved and secreted. IL1B lacks any known signal sequence and the pathway(s) of its secretion is(are) not yet fully understood (PubMed:24201029). On the basis of experimental results, several unconventional secretion mechanisms have been proposed. 1. Secretion via secretory lysosomes: a fraction of CASP1 and IL1B precursor may be incorporated, by a yet undefined mechanism, into secretory lysosomes that undergo Ca(2+)-dependent exocytosis with release of mature IL1B (PubMed:15192144). 2. Secretory autophagy: IL1B-containing autophagosomes may fuse with endosomes or multivesicular bodies (MVBs) and then merge with the plasma membrane releasing soluble IL1B or IL1B-containing exosomes (PubMed:24201029). However, autophagy impacts IL1B production at several levels and its role in secretion is still controversial. 3. Secretion via exosomes: ATP-activation of P2RX7 leads to the formation of MVBs containing exosomes with entrapped IL1B, CASP1 and other inflammasome components. These MVBs undergo exocytosis with the release of exosomes. The release of soluble IL1B occurs after the lysis of exosome membranes (By similarity). 4. Secretion by microvesicle shedding: activation of the ATP receptor P2RX7 may induce an immediate shedding of membrane-derived microvesicles containing IL1B and possibly inflammasome components. The cytokine is then released in the extracellular compartment after microvesicle lysis (PubMed:11728343). 5. Release by translocation through permeabilized plasma membrane. This may occur in cells undergoing pyroptosis due to sustained activation of the inflammasome (By similarity). These mechanisms may not be not mutually exclusive.

Tissue Specificity:

Expressed in activated monocytes/macrophages (at protein level).

Subunit Structure:

Monomer. In its precursor form, weakly interacts with full-length MEFV; the mature cytokine does not interact at all. Interacts with integrins ITGAV:ITGBV and ITGA5:ITGB1; integrin-binding is required for IL1B signaling.

Family&Domains:

Belongs to the IL-1 family.

Research Fields

· Cellular Processes > Cell growth and death > Necroptosis. (View pathway)

· Environmental Information Processing > Signal transduction > MAPK signaling pathway. (View pathway)

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction. (View pathway)

· Environmental Information Processing > Signal transduction > NF-kappa B signaling pathway. (View pathway)

· Environmental Information Processing > Signal transduction > TNF signaling pathway. (View pathway)

· Human Diseases > Drug resistance: Antineoplastic > Antifolate resistance.

· Human Diseases > Endocrine and metabolic diseases > Non-alcoholic fatty liver disease (NAFLD).

· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.

· Human Diseases > Neurodegenerative diseases > Alzheimer's disease.

· Human Diseases > Neurodegenerative diseases > Prion diseases.

· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.

· Human Diseases > Infectious diseases: Bacterial > Pertussis.

· Human Diseases > Infectious diseases: Bacterial > Legionellosis.

· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.

· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).

· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.

· Human Diseases > Infectious diseases: Parasitic > Malaria.

· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.

· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.

· Human Diseases > Infectious diseases: Viral > Measles.

· Human Diseases > Infectious diseases: Viral > Influenza A.

· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.

· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).

· Human Diseases > Immune diseases > Rheumatoid arthritis.

· Human Diseases > Immune diseases > Graft-versus-host disease.

· Organismal Systems > Development > Osteoclast differentiation. (View pathway)

· Organismal Systems > Immune system > Toll-like receptor signaling pathway. (View pathway)

· Organismal Systems > Immune system > NOD-like receptor signaling pathway. (View pathway)

· Organismal Systems > Immune system > Cytosolic DNA-sensing pathway. (View pathway)

· Organismal Systems > Immune system > Hematopoietic cell lineage. (View pathway)

· Organismal Systems > Immune system > IL-17 signaling pathway. (View pathway)

· Organismal Systems > Immune system > Th17 cell differentiation. (View pathway)

· Organismal Systems > Sensory system > Inflammatory mediator regulation of TRP channels. (View pathway)

References

1). Natural Cell Patches: Melanin Nanoparticles for MR Imaging-Guided Antiatherosclerosis Therapy via Attenuating Macrophage Pyroptosis. ADVANCED FUNCTIONAL MATERIALS [IF=19.0]

2). Single-atom nanozymes catalytically surpassing naturally occurring enzymes as sustained stitching for brain trauma. Nature Communications (PubMed: 35961961) [IF=16.6]

3). Toxin-Enabled “On-Demand” Liposomes for Enhanced Phototherapy to Treat and Protect against Methicillin-Resistant Staphylococcus aureus Infection. Small (PubMed: 35859534) [IF=13.3]

4). Environmental endocrine disruptor Bisphenol A induces metabolic derailment and obesity via upregulating IL-17A in adipocytes. ENVIRONMENT INTERNATIONAL (PubMed: 36696794) [IF=11.8]

5). An in situ tissue engineering scaffold with growth factors combining angiogenesis and osteoimmunomodulatory functions for advanced periodontal bone regeneration. JOURNAL OF NANOBIOTECHNOLOGY (PubMed: 34404409) [IF=10.2]

6). Bacterial Toxin‐Responsive Biomimetic Nanobubbles for Precision Photodynamic Therapy against Bacterial Infections. Advanced Healthcare Materials (PubMed: 35836329) [IF=10.0]

7). Micheliolide Ameliorates Diabetic Kidney Disease by Inhibiting Mtdh-mediated Renal Inflammation in Type 2 Diabetic db/db Mice. PHARMACOLOGICAL RESEARCH (PubMed: 31669149) [IF=9.3]

8). Betulinic Acid Inhibits ROS-Mediated Pyroptosis in Spinal Cord Injury by Augmenting Autophagy via the AMPK-mTOR-TFEB Signaling Pathway. International Journal of Biological Sciences (PubMed: 33867836) [IF=9.2]

Application: WB Species: Mice Sample: spinal cords

Figure 2 BA attenuates pyroptosis after SCI. (A) Immunofluorescence staining for Caspase-1 and NeuN co-localization in the spinal cords of the Sham, SCI, and BA groups (scale bar = 25 µm) (B) The quantitative mean optical density of the Caspase-1 in motor neurons of spinal cord lesion. (C) Immunofluorescence staining for GSDMD and NeuN co-localization in the spinal cords of the Sham, SCI, and BA groups (scale bar = 25 µm) (D) The quantitative mean optical density of the GSDMD in motor neurons of spinal cord lesion. (E)Western blotting for ASC, Caspase-1, GSDMD, IL-1β, IL-18 and NLRP3 expression levels in the Sham, SCI, and BA groups. The gels were run under the same experimental conditions, and the cropped blots are shown here. (F) The optical density values of the ASC, Caspase-1, GSDMD, IL-1β, IL-18 and NLRP3 expression levels were quantified and analyzed in each group. The values are expressed as the means ± SEM, n=5 per group. **p< 0.01, vs. Sham group. #p< 0.05 and ##p< 0.01, vs. SCI group.

9). TRPV4-induced inflammatory response is involved in neuronal death in pilocarpine model of temporal lobe epilepsy in mice. Cell Death & Disease (PubMed: 31097691) [IF=9.0]

Application: WB Species: mouse Sample: NRLP3 inflammasome

Fig. 2| TRPV4 agonist increases NRLP3 inflammasome expression and proinflammatory cytokine production. a–c The hippocampal protein levels of NLRP3 (a), ASC (b) and caspase-1 (c) in control and GSK1016790A-injected mice. **P < 0.01 vs. control. d–f Icv. of TRPV4 agonist GSK1016790A markedly increased the protein levels of IL-1β (d), TNF-α (e) and IL-6 (f) in hippocampi.

10). Combination of resolvin E1 and lipoxin A4 promotes the resolution of pulpitis by inhibiting NF-κB activation through upregulating sirtuin 7 in dental pulp fibroblasts. CELL PROLIFERATION (PubMed: 35411569) [IF=8.5]

Application: WB Species: rat Sample: Dental pulp fibroblasts

FIGURE 1 |Effects of combined administration of RvE1 and LXA4 on pro-inflammatory factor expression.(C) NLRP3, (D) caspase-1, (E) IL-1β and (F) IL-18 mRNA levels on LPS-induced DPFs detected by qPCR and (G) their protein levels tested by western blotting (normalized to that of β-tubulin).

Restrictive clause

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.

IL1 beta Antibody - #AF5103

Related products

Related Downloads

MS Report

HPLC Report

MSDS

Data Sheet

COA

Protocols

WB Handbook

IHC Protocol

IF/ICC Protocol

Product Info

Immunogens

Predictions

PTMs - P01584 As Substrate

Research Backgrounds

Research Fields

References

Restrictive clause