Product: CD8 Antibody
Catalog: AF5126
Source: Rabbit
Application: WB, IHC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 25 kD; 26kD(Calculated).
Uniprot: P01732
RRID: AB_2837612

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
CD8 Antibody detects endogenous levels of total CD8.
RRID:
AB_2837612
Cite Format: Affinity Biosciences Cat# AF5126, RRID:AB_2837612.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

alpha polypeptide (p32); CD8; CD8 antigen alpha polypeptide; CD8 antigen alpha polypeptide (p32); CD8a; CD8A antigen; CD8A molecule; CD8A_HUMAN; Leu2; Leu2 T lymphocyte antigen; Ly3; LYT3; MAL; OKT8 T cell antigen; OTTHUMP00000160760; OTTHUMP00000160764; OTTHUMP00000203528; OTTHUMP00000203721; p32; T cell antigen Leu2; T cell co receptor; T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2; T8 T cell antigen; T8/Leu-2 T-lymphocyte differentiation antigen;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P01732 CD8A_HUMAN:

CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and dendritic cells expresses CD8A homodimers. Expressed at the cell surface of plasmacytoid dendritic cells upon herpes simplex virus-1 stimulation.

Description:
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
Sequence:
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
70
Pig
0
Horse
0
Bovine
0
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P01732 As Substrate

Site PTM Type Enzyme
S224 Phosphorylation
S229 Phosphorylation
S231 Phosphorylation

Research Backgrounds

Function:

Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells.

PTMs:

Palmitoylated, but association with CD8B seems to be more important for the enrichment of CD8A in lipid rafts.

O-glycosylated.

Phosphorylated in cytotoxic T-lymphocytes (CTLs) following activation.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.
Note: CD8A localizes to lipid rafts only when associated with its partner CD8B.

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and dendritic cells expresses CD8A homodimers. Expressed at the cell surface of plasmacytoid dendritic cells upon herpes simplex virus-1 stimulation.

Subunit Structure:

Forms disulfide-linked heterodimers with CD8B at the cell surface. Forms also homodimers in several cell types including NK-cells or peripheral blood T-lymphocytes. Interacts with the MHC class I HLA-A/B2M dimer. One HLA-A molecule (mainly via nonpolymorphic alpha-3 domain) interacts with one CD8A homodimer (via CDR-like loop). Interacts with LCK in a zinc-dependent manner. Interacts with HLA-G; this interaction is direct and might down-regulate T cell receptor signaling.

Research Fields

· Environmental Information Processing > Signaling molecules and interaction > Cell adhesion molecules (CAMs).   (View pathway)

· Human Diseases > Immune diseases > Primary immunodeficiency.

· Organismal Systems > Immune system > Antigen processing and presentation.   (View pathway)

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

· Organismal Systems > Immune system > T cell receptor signaling pathway.   (View pathway)

References

1). Zhang Y et al. Machine-Learning Algorithm-Based Prediction of Diagnostic Gene Biomarkers Related to Immune Infiltration in Patients With Chronic Obstructive Pulmonary Disease. Front Immunol 2022 Mar 8;13:740513. (PubMed: 35350787) [IF=5.085]

2). Liu MB et al. Icariside II attenuates cerebral ischemia/reperfusion-induced blood–brain barrier dysfunction in rats via regulating the balance of MMP9/TIMP1. Acta Pharmacol Sin 2020 Jun 2. (PubMed: 32488170) [IF=5.064]

3). Jiang LR et al. PD-1-Positive Tumor-Associated Macrophages Define Poor Clinical Outcomes in Patients With Muscle Invasive Bladder Cancer Through Potential CD68/PD-1 Complex Interactions. Front Oncol 2021 May 17;11:679928. (PubMed: 34079767) [IF=4.848]

Application: IHC    Species: Human    Sample: TAMs

FIGURE 3 | (A) Immunohistochemical staining of PD-1-positive TAMs (red arrow), PD-1-negative TAMs (purple arrow), strong PD-L1 and weak PD-L1 expression. (B) Kaplan-Meier analysis of OS in patients with MIBC with PD-1-positive TAMs in the Shanghai General Hospital cohort. (C) Kaplan-Meier analysis of DFS in patients with MIBC with PD-1-positive TAMs in the Shanghai General Hospital cohort. (D) PD-1-positive TAMs showed less CD8-postive T cells nearby. ***p < 0.001 (Student’s t-test). (E) The number of PD-1-positive TAMs showed a correlation with PD-L1 expression in the Shanghai General Hospital cohort.

4). Deng T et al. ASPM Is a Prognostic Biomarker and Correlates With Immune Infiltration in Kidney Renal Clear Cell Carcinoma and Liver Hepatocellular Carcinoma. Front Oncol 2022 Apr 20;12:632042. (PubMed: 35515103) [IF=4.848]

5). Chen R et al. Alantolactone-loaded chitosan/hyaluronic acid nanoparticles suppress psoriasis by deactivating STAT3 pathway and restricting immune cell recruitment. Asian J Pharm Sci 2022 Mar;17(2):268-283. (PubMed: 35582636) [IF=3.968]

6). Cui S et al. Depression promotes lung carcinoma progression by regulating the tumor microenvironment in tumor-bearing models of C57BL/6J mice. Neurosci Lett 2021 May 29;754:135851. (PubMed: 33781910)

Application: IHC    Species: Mice    Sample: tumor tissue

Fig. 5. Relative protein levels of CD8, MMP2, MMP9, PD-L1 and VEGF in tumor tissue specimens. (A)- (E) The protein expression in the tumor tissues by immunohistochemical staining. Statistical analyses of single comparison were conducted through the Student’s t-test. All data are presented as mean ± SD, *p < 0.05, **p < 0.01, n = 3 per group. Bar: 50 μm (low magnification); 20 μm (high magnification).

Application: WB    Species: Mice    Sample: tumor tissues

Fig. 6. WB of protein expression in tumor tissues and correlation analysis between the depression-like behaviors and protein expression. (A) The bands of protein expression. (B)-(F) Correlation analysis between the depression-like behaviors and protein expression. Statistical analyses of single comparison were conducted through the Student’s t-test. All data are presented as mean ± SD, *p < 0.05, **p < 0.01, n = 3 per group.

7). Shang J et al. CircPAN3 contributes to drug resistance in acute myeloid leukemia through regulation of autophagy. Leuk Res 2019 Aug 2;85:106198 (PubMed: 31401408)

8). Gemcitabine and Celecoxib Synergistically Promote Long-Lasting Antitumor Efficacy of Pd-1 Antibody by Triggering Immunogenic Cell Death.

9). Alantolactone-loaded chitosan/hyaluronic acid nanoparticles suppress psoriasis by deactivating STAT3 pathway and restricting immune cell recruitment.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.