Product: CD55 Antibody
Catalog: AF5259
Description: Rabbit polyclonal antibody to CD55
Application: WB IHC IF/ICC
Reactivity: Human, Mouse, Rat
Prediction: Dog
Mol.Wt.: 41 kDa, 60 kDa; 41kD(Calculated).
Uniprot: P08174
RRID: AB_2837745

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200
*The optimal dilutions should be determined by the end user.
*Tips:

WB: For western blot detection of denatured protein samples. IHC: For immunohistochemical detection of paraffin sections (IHC-p) or frozen sections (IHC-f) of tissue samples. IF/ICC: For immunofluorescence detection of cell samples. ELISA(peptide): For ELISA detection of antigenic peptide.

Reactivity:
Human,Mouse,Rat
Prediction:
Dog(80%)
Clonality:
Polyclonal
Specificity:
CD55 Antibody detects endogenous levels of total CD55.
RRID:
AB_2837745
Cite Format: Affinity Biosciences Cat# AF5259, RRID:AB_2837745.
Conjugate:
Unconjugated.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

CD 55; CD55; CD55 antigen; CD55 Cromer blood group system; CD55 molecule (Cromer blood group); CD55 molecule; CD55 molecule, decay accelerating factor for complement (Cromer blood group); Cd55a; Complement decay accelerating factor; Complement decay-accelerating factor; Complement decay-accelerating factor, GPI-anchored; CR; CROM; Cromer Blood Group antigen; Cromer blood group system; DAF; Daf-GPI; DAF_HUMAN; Daf1; Dcay accelerating factor for complement (CD55, Cromer blood group system); Decay accelarating factor 1, isoform CRA_a; Decay accelerating factor (GPI-form); Decay Accelerating Factor for Complement; Decay accelerating factor GPI-form; Decay accelerating factor soluble-form; GPI-DAF; TC;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P08174 DAF_HUMAN:

Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body fluids and in extracellular matrix.

Description:
This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation.
Sequence:
MTVARPSVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLSGHTCFTLTGLLGTLVTMGLLT

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Dog
80
Bovine
78
Pig
0
Horse
0
Sheep
0
Xenopus
0
Zebrafish
0
Chicken
0
Rabbit
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P08174 As Substrate

Site PTM Type Enzyme
K64 Ubiquitination
K71 Ubiquitination
K76 Ubiquitination
N95 N-Glycosylation
K110 Ubiquitination
S140 Phosphorylation
K142 Ubiquitination
S162 Phosphorylation
Y245 Phosphorylation
Y251 Phosphorylation
Y266 Phosphorylation
K291 Ubiquitination
K298 Ubiquitination
S310 Phosphorylation
K315 Ubiquitination
K319 Ubiquitination
S334 Phosphorylation
K338 Ubiquitination
T343 O-Glycosylation
T344 O-Glycosylation
K347 Ubiquitination

Research Backgrounds

Function:

This protein recognizes C4b and C3b fragments that condense with cell-surface hydroxyl or amino groups when nascent C4b and C3b are locally generated during C4 and c3 activation. Interaction of daf with cell-associated C4b and C3b polypeptides interferes with their ability to catalyze the conversion of C2 and factor B to enzymatically active C2a and Bb and thereby prevents the formation of C4b2a and C3bBb, the amplification convertases of the complement cascade. Inhibits complement activation by destabilizing and preventing the formation of C3 and C5 convertases, which prevents complement damage.

(Microbial infection) Acts as a receptor for Coxsackievirus A21, coxsackieviruses B1, B3 and B5.

(Microbial infection) Acts as a receptor for Human enterovirus 70 and D68 (Probable).

(Microbial infection) Acts as a receptor for Human echoviruses 6, 7, 11, 12, 20 and 21.

PTMs:

The Ser/Thr-rich domain is heavily O-glycosylated.

Subcellular Location:

Cell membrane>Single-pass type I membrane protein.

Cell membrane>Lipid-anchor.

Secreted.

Secreted.

Secreted.

Cell membrane>Lipid-anchor.

Cell membrane>Lipid-anchor.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed on the plasma membranes of all cell types that are in intimate contact with plasma complement proteins. It is also found on the surfaces of epithelial cells lining extracellular compartments, and variants of the molecule are present in body fluids and in extracellular matrix.

Subunit Structure:

Monomer (major form) and non-disulfide-linked, covalent homodimer (minor form).

(Microbial infection) Interacts with coxsackievirus A21, coxsackieviruses B1, B3 and B5 capsid proteins.

(Microbial infection) Interacts with human enterovirus 70 and D68 capsid proteins (Probable).

(Microbial infection) Interacts with human echoviruses 6, 7, 11, 12, 20 and 21 capsid proteins.

Family&Domains:

The first Sushi domain (SCR1) is not necessary for function. SCR2 and SCR4 provide the proper conformation for the active site on SCR3 (By similarity).

Belongs to the receptors of complement activation (RCA) family.

Research Fields

· Human Diseases > Cardiovascular diseases > Viral myocarditis.

· Organismal Systems > Immune system > Complement and coagulation cascades.   (View pathway)

· Organismal Systems > Immune system > Hematopoietic cell lineage.   (View pathway)

References

1). Yes associated protein 1 promotes resistance to 5-fluorouracil in gastric cancer by regulating GLUT3-dependent glycometabolism reprogramming of tumor-associated macrophages. ARCHIVES OF BIOCHEMISTRY AND BIOPHYSICS (PubMed: 33727040) [IF=3.9]

Application: WB    Species: Mice    Sample: GC cells

Fig. 3. IL13 secreted by YAP1-overexpressed GC cells stimulates resistance to 5-FU via inducing M2 subtype macrophage glycolysis reprogramming. A-C. RT-PCR was used to detect the mRNA expression of glycolysis enzymes, fatty acid and amino acid metabolism enzymes in THP1 after co-cultured with MKN-YAP1 or MKN45-Vetor. D. Protein level change of glycolysis enzymes in THP1 after co-cultured with MKN-YAP1, MKN45-Vetor, SGC7901-siYAP1 or SGC7901-NC. E. RT-PCR revealed the mRNA expression of glycolysis enzymes and M2 TAMs markers in THP1 after co-cultured with SGC7901-siYAP1 or SGC7901-NC. F-G. Relative lactate release from cells was determined by colorimetric analysis. Relative glucose uptake cells by Flow cytometry detection. All data presented are the mean ± SD (*p < 0.05, **p < 0.01) of triplicate determination from three independent experiments.

2). Improved production of GTKO/hCD55/hCD59 triple-gene-modified Diannan miniature pigs for xenotransplantation by recloning. TRANSGENIC RESEARCH (PubMed: 32358721) [IF=3.0]

Application: WB    Species: human    Sample: 293T (human cell positive control) and fetuses F6# and F11#

Fig. 1 | Generation and identification of fetuses with GTKO/hCD55/hCD59. a Detection of GGTA1 (752-bp PCR product) in fetuses by PCR. b Genotyping of GGTA1 mutant fetuses by the T7EI assay. c The detection of hCD55 and hCD59 in fetuses by PCR. d Sequences of the GGTA1 and its mutations in WT,donor cells and fetuses. e The expression of hCD55 and hCD59 in 293T (human cell positive control) and fetuses F6# and F11#determined by western blotting

Application: IF/ICC    Species: piglet    Sample: kidneys

Fig. 3 |a Expression of GGTA1, hCD55 and hCD59 in the kidneys of piglet P5#by immunofluorescence. Green and red indicate the protein of interest. Scale bars = 100 lm at 9 200 magnification.

3). Generation of GTKO Diannan Miniature Pig Expressing Human Complementary Regulator Proteins hCD55 and hCD59 via T2A Peptide-Based Bicistronic Vectors and SCNT. MOLECULAR BIOTECHNOLOGY (PubMed: 29916131) [IF=2.6]

Application: IHC    Species: pig    Sample: heart、liver、kidney and pancreas

Fig. 4|  IHC analysis in various tissues of GTKO/hCD55/hCD59 genetically modified piglet. a–c The GGTA1, hCD55, and hCD59 expression levels in fibroblasts from control and GTKO/hCD55/hCD59 piglets were measured by immunohistochemistry. The brown color indicates the protein of interest. Scale bars = 80 µm at ×200 magnification

Application: WB    Species: pig    Sample: liver and kidney

Fig. 5|  The expression analysis of hCD55 and hCD59 in GTKO/hCD55/hCD59 genetically modified piglet and human serum-mediated cytotoxicity. c The protein levels of hCD55 and hCD59 in the liver and kidney tissues analyzed by western blotting.

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.