Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    CCR7 Antibody
  • Catalog No.
    AF5293
  • RRID
    AB_2837778
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Rabbit, Dog
  • UniProt
  • Mol.Wt
    42 kD;
    43kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

BLR 2; BLR2; C C chemokine receptor type 7; C C CKR 7; C-C chemokine receptor type 7; C-C CKR-7; CC chemokine receptor 7; CC chemokine receptor type 7; CC CKR 7; CC-CKR-7; CCCKR7; CCR 7; CCR-7; Ccr7; CCR7_HUMAN; CD 197; CD197; CD197 antigen; CDw197; Chemokine (C C motif) receptor 7; Chemokine (C C) receptor 7; Chemokine C C motif receptor 7; Chemokine C C receptor 7; Chemokine receptor 7; Chemokine receptor 7-like protein; CMKBR7; EBI 1; EBI1; Ebi1h; EBV Induced G Protein Coupled Receptor 1; EBV-induced G-protein coupled receptor 1; Epstein Barr virus induced G protein coupled receptor; Epstein Barr virus induced gene 1; Epstein-Barr virus-induced G-protein coupled receptor 1; EVI 1; EVI1; Lymphocyte Specific G Protein Coupled Peptide Receptor; MGC108519; MIP 3 beta receptor; MIP-3 beta receptor; MIP3 Beta Receptor;

Applications:

WB 1:500-1:2000, IF/ICC 1:100-1:500, IHC 1:50-1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Rabbit, Dog

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

CCR7 Antibody detects endogenous levels of total CCR7.

RRID:

AB_2837778
Please cite this product as: Affinity Biosciences Cat# AF5293, RRID:AB_2837778.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human CCR7, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

CCR7

Molecular Weight:

Observed Mol.Wt.: 42 kD.
Predicted Mol.Wt.: 43kDa(Calculated)..

Subcellular Location:

Cell membrane.

Tissue Specificity:

P32248 CCR7_HUMAN:
Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.

Description:

Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.

Sequence:
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP

Research Background

Function:

Receptor for the MIP-3-beta chemokine. Probable mediator of EBV effects on B-lymphocytes or of normal lymphocyte functions.

Subcellular Location:

Cell membrane>Multi-pass membrane protein.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Expressed in various lymphoid tissues and activated B- and T-lymphocytes, strongly up-regulated in B-cells infected with Epstein-Barr virus and T-cells infected with herpesvirus 6 or 7.

Similarity:

Belongs to the G-protein coupled receptor 1 family.

Research Fields

Research Fields:

· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.(View pathway)
· Organismal Systems > Immune system > Chemokine signaling pathway.(View pathway)

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

AF5293-BP
(Blocking peptide available as AF5293-BP)

Price/Size :

$350/1mg.
Tips: For phospho antibody, we provide phospho peptide(0.5mg) and non-phospho peptide(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Rabbit
83%
Dog
83%
Pig
75%
Bovine
75%
Sheep
75%
Horse
73%
Xenopus
0%
Zebrafish
0%
Chicken
0%
High similarity Medium similarity Low similarity No similarity
P32248 as Substrate
Site PTM Type Enzyme
Y65 Phosphorylation
S66 Phosphorylation
S151 Phosphorylation
Y155 Phosphorylation P12931 (SRC)
K342 Ubiquitination
S356 Phosphorylation
S357 Phosphorylation
S364 Phosphorylation
S365 Phosphorylation
T372 Phosphorylation
T373 Phosphorylation
T374 Phosphorylation
T375 Phosphorylation
S377 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top