Product: HO-1 Antibody
Catalog: AF5393
Source: Rabbit
Application: WB, IHC, ELISA(peptide)
Reactivity: Human, Mouse, Rat
Mol.Wt.: 33 kD; 33kD(Calculated).
Uniprot: P09601
RRID: AB_2837878

View similar products>>

   Size Price Inventory
 100ul $280 In stock
 200ul $350 In stock

Lead Time: Same day delivery

For pricing and ordering contact:
Local distributors

Product Info

Source:
Rabbit
Application:
WB 1:500-1:2000, IHC 1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.
Reactivity:
Human,Mouse,Rat
Clonality:
Polyclonal
Specificity:
HO-1 Antibody detects endogenous levels of total HO-1.
RRID:
AB_2837878
Cite Format: Affinity Biosciences Cat# AF5393, RRID:AB_2837878.
Purification:
The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).
Storage:
Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
Alias:

Fold/Unfold

32 kD; bK286B10; D8Wsu38e; heat shock protein 32 kD; heat shock protein 32kD; Heat shock protein; Heme oxygenase (decycling) 1; Heme oxygenase 1; Hemox; HMOX 1; Hmox; Hmox1; HMOX1_HUMAN; HO 1; HO; HO-1; HO1; Hsp32;

Immunogens

Immunogen:
Uniprot:
Gene(ID):
Expression:
P09601 HMOX1_HUMAN:

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).

Description:
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed.
Sequence:
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

Predictions

Predictions:

Score>80(red) has high confidence and is suggested to be used for WB detection. *The prediction model is mainly based on the alignment of immunogen sequences, the results are for reference only, not as the basis of quality assurance.

Species
Results
Score
Rabbit
75
Pig
67
Horse
67
Bovine
67
Sheep
67
Dog
67
Xenopus
0
Zebrafish
0
Chicken
0
Model Confidence:
High(score>80) Medium(80>score>50) Low(score<50) No confidence

PTMs - P09601 As Substrate

Site PTM Type Enzyme
K18 Acetylation
K18 Ubiquitination
K22 Ubiquitination
K39 Acetylation
K39 Ubiquitination
S53 Phosphorylation
Y55 Phosphorylation
Y58 Phosphorylation
K69 Ubiquitination
K86 Ubiquitination
T108 Phosphorylation
Y114 Phosphorylation
Y137 Phosphorylation
K148 Ubiquitination
K149 Ubiquitination
K153 Ubiquitination
S160 Phosphorylation
K177 Ubiquitination
K179 Ubiquitination
S188 Phosphorylation P31749 (AKT1)
T192 Phosphorylation
S229 Phosphorylation
S231 Phosphorylation
K243 Acetylation
K243 Ubiquitination
T252 Phosphorylation
K256 Acetylation
K256 Ubiquitination
Y286 Phosphorylation

Research Backgrounds

Function:

Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.

Subcellular Location:

Microsome. Endoplasmic reticulum membrane>Peripheral membrane protein>Cytoplasmic side.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionSubcellular location
Tissue Specificity:

Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level).

Family&Domains:

Belongs to the heme oxygenase family.

Research Fields

· Cellular Processes > Cell growth and death > Ferroptosis.   (View pathway)

· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.   (View pathway)

· Human Diseases > Cancers: Overview > Pathways in cancer.   (View pathway)

· Human Diseases > Cancers: Overview > MicroRNAs in cancer.

· Human Diseases > Cancers: Specific types > Hepatocellular carcinoma.   (View pathway)

· Metabolism > Metabolism of cofactors and vitamins > Porphyrin and chlorophyll metabolism.

· Metabolism > Global and overview maps > Metabolic pathways.

· Organismal Systems > Digestive system > Mineral absorption.

References

1). Chen X et al. Mitochondria-targeted supramolecular coordination container encapsulated with exogenous itaconate for synergistic therapy of joint inflammation. Theranostics 2022 Apr 4;12(7):3251-3272. (PubMed: 35547753) [IF=8.579]

2). Ding S et al. Sensitive and Selective Measurement of Hydroxyl Radicals at Subcellular Level with Tungsten Nanoelectrodes. Anal Chem 2020 Jan 13 (PubMed: 31927939) [IF=6.785]

Application: WB    Species: Mouse    Sample: single cells

Figure 4. (A) Differential pulse voltammograms of HAT/Au/WNE recorded in 0.1 M PBS solution (pH 7.4) containing 10 mM K3Fe(CN)6 (a) before being inserted into cells and after being inserted into the cytoplasm of single cells, (b) with 20 μM Aβ stimulation, (c) with 20 μM Aβ stimulation in the presence of 10 μM cordycepin, or (d) with 20 μM Aβ stimulation in the presence of 10 μM cordycepin and 10 μM LY294002. The HAT/Au/WNE was kept in cells for 15 min to react with the intracellular • OH. (B) Corresponding • OH concentration changes. (C) Western blot analysis of the HO-1 expression. (D) Schematic representation showing the role of cordycepin in the cytoprotection of Aβ-induced injury. The results are presented as mean ± standard deviation (n = 5). Significant differences (***p < 0.001) are performed by Student’s t test.

3). Liu P et al. Cytotoxicity of adducts formed between quercetin and methylglyoxal in PC-12 cells. Food Chem 2021 Aug 1;352:129424. (PubMed: 33706136) [IF=6.306]

4). Yang J et al. Cetuximab promotes RSL3-induced ferroptosis by suppressing the Nrf2/HO-1 signalling pathway in KRAS mutant colorectal cancer. Cell Death Dis 2021 Nov 13;12(11):1079. (PubMed: 34775496) [IF=6.304]

5). Waltz PK et al. Heme Oxygenase-2 Localizes to Mitochondria and Regulates Hypoxic Responses in Hepatocytes. Oxid Med Cell Longev 2018 Apr 12;2018:2021645 (PubMed: 29849867) [IF=5.076]

Application: WB    Species: mouse    Sample: hepatocytes

Figure 1|HO-2 is present within hepatocyte mitochondria under unstressed conditions. (a, b) Microscopy reveals localization of HO-2 within the mitochondria. Immunocytochemistry (a) demonstrates mitochondria (green; MitoTracker) and HO-2 (red) with areas of yellow representing colocalization. Immunoelectron microscopy demonstrates gold particle-labeled localization of HO-2 within hepatocyte mitochondria under normal cell culture conditions (b). (c, d) Western blot of mitochondrial fractions of untreated primary hepatocytes(c) and mouse liver (d) demonstrates HO-2 but not HO-1 expression protein levels under basal cell culture or without treatment.Mitochondrial cytochrome C oxidase subunit 4 (COX IV) is used as a mitochondrial loading control.

6). Wang Y et al. Pentoxifylline Enhances Antioxidative Capability and Promotes Mitochondrial Biogenesis in D-Galactose-Induced Aging Mice by Increasing Nrf2 and PGC-1α through the cAMP-CREB Pathway. Oxid Med Cell Longev 2021 Jun 22;2021:6695613. (PubMed: 34257818) [IF=5.076]

7). Waltz PK et al. Heme Oxygenase-2 Localizes to Mitochondria and Regulates Hypoxic Responses in Hepatocytes. Oxid Med Cell Longev 2018 Apr 12;2018:2021645 (PubMed: 29849867) [IF=5.076]

8). Ren B et al. Nrf2 Deficiency Attenuates Testosterone Efficiency in Ameliorating Mitochondrial Function of the Substantia Nigra in Aged Male Mice. Oxid Med Cell Longev 2022 Feb 18;2022:3644318. (PubMed: 35222795) [IF=5.076]

9). Lu H et al. Rosiglitazone Suppresses Renal Crystal Deposition by Ameliorating Tubular Injury Resulted from Oxidative Stress and Inflammatory Response via Promoting the Nrf2/HO-1 Pathway and Shifting Macrophage Polarization. Oxid Med Cell Longev 2021 Oct 14;2021:5527137. (PubMed: 34691355) [IF=5.076]

10). Ni B et al. Nrf2 Pathway Ameliorates Bladder Dysfunction in Cyclophosphamide-Induced Cystitis via Suppression of Oxidative Stress. Oxid Med Cell Longev 2021 Jun 30;2021:4009308. (PubMed: 34306306) [IF=5.076]

Load more

Restrictive clause

 

Affinity Biosciences tests all products strictly. Citations are provided as a resource for additional applications that have not been validated by Affinity Biosciences. Please choose the appropriate format for each application and consult Materials and Methods sections for additional details about the use of any product in these publications.

For Research Use Only.
Not for use in diagnostic or therapeutic procedures. Not for resale. Not for distribution without written consent. Affinity Biosciences will not be held responsible for patent infringement or other violations that may occur with the use of our products. Affinity Biosciences, Affinity Biosciences Logo and all other trademarks are the property of Affinity Biosciences LTD.