Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    Interferon gamma Antibody
  • Catalog No.
    DF6045
  • RRID
    AB_2838015
  • Source
    Rabbit
  • Application
    WB,IHC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • UniProt
  • Mol.Wt
    19-25kD;
    19kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

IFG; IFI; IFN gamma; IFN, immune; IFN-gamma; IFNG; IFNG_HUMAN; Immune interferon; Interferon gamma;

Applications:

WB 1:500-1:2000, IHC 1:200, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

Interferon gamma Antibody detects endogenous levels of total Interferon gamma.

RRID:

AB_2838015
Please cite this product as: Affinity Biosciences Cat# DF6045, RRID:AB_2838015.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human Interferon gamma, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

IFNG

Molecular Weight:

Observed Mol.Wt.: 19-25kD.
Predicted Mol.Wt.: 19kDa(Calculated)..

Subcellular Location:

Secreted.

Tissue Specificity:

P01579 IFNG_HUMAN:
Released primarily from activated T lymphocytes.

Description:

Interferons (IFNs) appear both locally and systematically early after viral infection and participate in limiting the spread of infection. They also affect cell differentiation, growth, surface antigen expression and immunoregulation (1). There are three naturally occurring interferons: α, β and γ. IFN-α is derived from lymphoblastic tissue and has a number of therapeutic applications in the treatment of various human cancers and diseases of viral origin. Recombinant IFN-α from both natural and synthetic genes binds to a common cell surface receptor and induces antiviral activity in a variety of cell lines. When binding to discrete cell surface receptors on target cells, IFN-α induces rapid changes in Jak/Stat phosphorylation, which initiates the Jak/Stat signaling pathway (2). IFN-α signaling also involves production of DAG without an increased intracellular free calcium concentration and the subsequent activation of calcium-independent isoforms of PKC (β and ε) (3). All IFN-α signaling pathways lead to final alterations of gene expression, which mediate their pleiotropic biologic activities. IFN-γ, also known as type II interferon, is produced mainly in activated T lymphocytes and natural killer cells (4) and has broad effects on various cells of the immune system. Many signaling proteins including IL-2, FGF, and EGF induce the synthesis of IFN-γ.

Sequence:
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Research Background

Function:

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Post-translational Modifications:

Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161.

Subcellular Location:

Secreted.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Tissue Specificity:

Released primarily from activated T lymphocytes.

Subunit Structure:

Homodimer.

Similarity:

Belongs to the type II (or gamma) interferon family.

Research Fields

Research Fields:

· Cellular Processes > Cell growth and death > Necroptosis.(View pathway)
· Environmental Information Processing > Signaling molecules and interaction > Cytokine-cytokine receptor interaction.(View pathway)
· Environmental Information Processing > Signal transduction > HIF-1 signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > TGF-beta signaling pathway.(View pathway)
· Environmental Information Processing > Signal transduction > Jak-STAT signaling pathway.(View pathway)
· Genetic Information Processing > Folding, sorting and degradation > Proteasome.
· Human Diseases > Endocrine and metabolic diseases > Type I diabetes mellitus.
· Human Diseases > Infectious diseases: Bacterial > Salmonella infection.
· Human Diseases > Infectious diseases: Parasitic > Leishmaniasis.
· Human Diseases > Infectious diseases: Parasitic > Chagas disease (American trypanosomiasis).
· Human Diseases > Infectious diseases: Parasitic > African trypanosomiasis.
· Human Diseases > Infectious diseases: Parasitic > Malaria.
· Human Diseases > Infectious diseases: Parasitic > Toxoplasmosis.
· Human Diseases > Infectious diseases: Parasitic > Amoebiasis.
· Human Diseases > Infectious diseases: Bacterial > Tuberculosis.
· Human Diseases > Infectious diseases: Viral > Measles.
· Human Diseases > Infectious diseases: Viral > Influenza A.
· Human Diseases > Infectious diseases: Viral > Herpes simplex infection.
· Human Diseases > Infectious diseases: Viral > Epstein-Barr virus infection.
· Human Diseases > Cancers: Overview > Pathways in cancer.(View pathway)
· Human Diseases > Immune diseases > Inflammatory bowel disease (IBD).
· Human Diseases > Immune diseases > Systemic lupus erythematosus.
· Human Diseases > Immune diseases > Rheumatoid arthritis.
· Human Diseases > Immune diseases > Allograft rejection.
· Human Diseases > Immune diseases > Graft-versus-host disease.
· Organismal Systems > Development > Osteoclast differentiation.(View pathway)
· Organismal Systems > Immune system > Antigen processing and presentation.(View pathway)
· Organismal Systems > Immune system > Natural killer cell mediated cytotoxicity.(View pathway)
· Organismal Systems > Immune system > IL-17 signaling pathway.(View pathway)
· Organismal Systems > Immune system > Th1 and Th2 cell differentiation.(View pathway)
· Organismal Systems > Immune system > Th17 cell differentiation.(View pathway)
· Organismal Systems > Immune system > T cell receptor signaling pathway.(View pathway)

Reference Citations:

1). Chen X;Gao A;Zhang F;Yang Z;Wang S;Fang Y;Li J;Wang J;Shi W;Wang L;Zheng Y;Sun Y; et al. ILT4 inhibition prevents TAM- and dysfunctional T cell-mediated immunosuppression and enhances the efficacy of anti-PD-L1 therapy in NSCLC with EGFR activation. Theranostics 2021 Jan 19;11(7):3392-3416. (PubMed: 33537094) [IF=8.579]

2). Yarong Du et al. The Reduced Oligomerization of MAVS Mediated by ROS Enhances the Cellular Radioresistance. OXID MED CELL LONGEV 2020 Mar 4;Article ID 2167129 [IF=5.076]

3). Song Y;Xie F;Ma S;Deng G;Li Y;Nie Y;Wang F;Yu G;Gao Z;Chen K;Han L;Gao L; et al. Caveolin-1 protects against DSS-induced colitis through inhibiting intestinal nitrosative stress and mucosal barrier damage in mice. Biochem Pharmacol 2020 Jul 14;114153. (PubMed: 32679126) [IF=4.960]

4). Wang M et al. Berberine combined with cyclosporine A alleviates acute graft-versus-host disease in murine models. Int Immunopharmacol 2020 Feb 9;81:106205 (PubMed: 32050154) [IF=3.943]

5). Xie F;Zhang H;Zheng C;Shen XF; et al. Costunolide Improved Dextran Sulfate Sodium-Induced Acute Ulcerative Colitis in Mice Through NF-κB, STAT1/3, and Akt Signaling Pathways. Int Immunopharmacol 2020 May 12;84:106567. (PubMed: 32413737) [IF=3.943]

6). Yang Z;Gao A;Shi W;Wang J;Zhang X;Xu Z;Xu T;Zheng Y;Sun Y;Yang F; et al. ILT4 in Colorectal Cancer Cells Induces Suppressive T Cell Contexture and Disease Progression. Onco Targets Ther 2021 Jul 20;14:4239-4254. (PubMed: 34321889) [IF=3.337]

7). Tu W et al. Acupoint application inhibits nerve growth factor and attenuates allergic inflammation in allergic rhinitis model rats. J Inflamm (Lond) 2020 Feb 10;17:4 (PubMed: 32063751)

8). Geng ZK et al. Exploration of the mechanisms of Ge Gen Decoction against influenza A virus infection. Chin J Nat Med 2019 Sep;17(9):650-662 (PubMed: 31526500)

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF6045-BP
(Blocking peptide available as DF6045-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
75%
Sheep
75%
Rabbit
75%
Horse
63%
Bovine
63%
Dog
0%
Xenopus
0%
Zebrafish
0%
Chicken
0%
High similarity Medium similarity Low similarity No similarity
P01579 as Substrate
Site PTM Type Enzyme
N48 N-Glycosylation
S74 Phosphorylation
S92 Phosphorylation
S107 Phosphorylation
N120 N-Glycosylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top