Price Size
$280 100ul
$350 200ul

Same day delivery


For pricing and ordering contact:

local distributors
  • Product Name
    PSMA3 Antibody
  • Catalog No.
    DF6377
  • RRID
    AB_2838340
  • Source
    Rabbit
  • Application
    WB,IHC,IF/ICC,ELISA(peptide)
  • Reactivity
    Human, Mouse, Rat
  • Prediction
    Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus
  • UniProt
  • Mol.Wt
    28kD;
    28kDa(Calculated).
  • Concentration
    1mg/ml
  • Browse similar products>>

Related Products

Product Information

Alternative Names:Expand▼

HC8; Macropain subunit C8; MGC12306; MGC32631; Multicatalytic endopeptidase complex subunit C8; Proteasome (prosome macropain) subunit alpha type 3; Proteasome alpha 3 subunit; Proteasome component C8; Proteasome subunit alpha type 3; Proteasome subunit alpha type-3; Proteasome subunit C8; PSA3_HUMAN; PSC8; psmA3;

Applications:

WB 1:500-1:2000, IHC 1:50-1:200, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000
*The optimal dilutions should be determined by the end user.

Reactivity:

Human, Mouse, Rat

Predicted Reactivity:

Pig, Bovine, Horse, Sheep, Rabbit, Dog, Chicken, Xenopus

Source:

Rabbit

Clonality:

Polyclonal

Purification:

The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific).

Specificity:

PSMA3 Antibody detects endogenous levels of total PSMA3.

RRID:

AB_2838340
Please cite this product as: Affinity Biosciences Cat# DF6377, RRID:AB_2838340.

Format:

Liquid

Concentration:

1mg/ml

Storage Condition and Buffer:

Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt.

Immunogen Information in 3D

Immunogen:

A synthesized peptide derived from human PSMA3, corresponding to a region within the internal amino acids.

Uniprot:



>>Visit The Human Protein Atlas

Gene ID:

Gene Name:

PSMA3

Molecular Weight:

Observed Mol.Wt.: 28kD.
Predicted Mol.Wt.: 28kDa(Calculated)..

Subcellular Location:

Cytoplasm. Nucleus.

Description:

The 20S proteasome is the major proteolytic enzyme complex involved in intracellular protein degradation. It consists of four stacked rings, each with seven distinct subunits. The two outer layers are identical rings composed of α subunits (called PSMAs), and the two inner layers are identical rings composed of β subunits. While the catalytic sites are located on the β rings (1-3), the α subunits are important for assembly and as binding sites for regulatory proteins (4). Seven different α and ten different β proteasome genes have been identified in mammals (5). PA700, PA28, and PA200 are three major protein complexes that function as activators of the 20S proteasome. PA700 binds polyubiquitin with high affinity and associates with the 20S proteasome to form the 26S proteasome, which preferentially degrades poly-ubiquitinated proteins (1-3). The proteasome has a broad substrate spectrum that includes cell cycle regulators, signaling molecules, tumor suppressors, and transcription factors. By controlling the degradation of these intracellular proteins, the proteasome functions in cell cycle regulation, cancer development, immune responses, protein folding, and disease progression (6-9).

Sequence:
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Research Background

Function:

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.

Subcellular Location:

Cytoplasm. Nucleus.

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte

Subunit Structure:

The 26S proteasome consists of a 20S proteasome core and two 19S regulatory subunits. The 20S proteasome core is a barrel-shaped complex made of 28 subunits that are arranged in four stacked rings. The two outer rings are each formed by seven alpha subunits, and the two inner rings are formed by seven beta subunits. The proteolytic activity is exerted by three beta-subunits PSMB5, PSMB6 and PSMB7. Interacts with AURKB. Interacts with CDKN1A. Interacts with MDM2 and RB1. Interacts with the C-terminus of TBXA2R isoform 2. Interacts with DNAJB2.

(Microbial infection) Interacts with HIV-1 Tat protein.

(Microbial infection) Interacts with hepatitis C virus (HCV) F protein.

(Microbial infection) Interacts with Epstein-Barr virus EBNA3 proteins.

Similarity:

Belongs to the peptidase T1A family.

Research Fields

Research Fields:

· Genetic Information Processing > Folding, sorting and degradation > Proteasome.

No comment
Total 0 records, divided into1 pages. First Prev Next Last

Submit Review

Support JPG, GIF, PNG format only
captcha
Catalog Number :

DF6377-BP
(Blocking peptide available as DF6377-BP)

Price/Size :

$350/1mg.
Tips: For modified antibodies, we provide modified peptides(0.5mg) and non-modified peptides(0.5mg).

Function :

Blocking peptides are peptides that bind specifically to the target antibody and block antibody binding. These peptide usually contains the epitope recognized by the antibody. Antibodies bound to the blocking peptide no longer bind to the epitope on the target protein. This mechanism is useful when non-specific binding is an issue, for example, in Western blotting (immunoblot) and immunohistochemistry (IHC). By comparing the staining from the blocked antibody versus the antibody alone, one can see which staining is specific; Specific binding will be absent from the western blot or immunostaining performed with the neutralized antibody.

Format and storage :

Synthetic peptide was lyophilized with 100% acetonitrile and is supplied as a powder. Reconstitute with 0.1 ml DI water for a final concentration of 10 mg/ml.The purity is >90%,tested by HPLC and MS.Storage Maintain refrigerated at 2-8°C for up to 6 months. For long term storage store at -20°C.

Precautions :

This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Pig
100%
Horse
100%
Bovine
100%
Sheep
100%
Dog
100%
Chicken
100%
Rabbit
100%
Xenopus
88%
Zebrafish
75%
High similarity Medium similarity Low similarity No similarity
P25788 as Substrate
Site PTM Type Enzyme
S2 Acetylation
Y8 Phosphorylation
S16 Phosphorylation
K29 Ubiquitination
T36 Phosphorylation
K43 Ubiquitination
K52 Ubiquitination
K57 Acetylation
K57 Ubiquitination
K65 Acetylation
K65 Ubiquitination
S97 Phosphorylation
S101 Phosphorylation
Y105 Phosphorylation
K110 Acetylation
K110 Ubiquitination
Y161 Phosphorylation
K174 Ubiquitination
K179 Ubiquitination
K183 Ubiquitination
T186 Phosphorylation
K192 Ubiquitination
Y199 Phosphorylation
K206 Acetylation
K206 Ubiquitination
K230 Acetylation
K230 Ubiquitination
K238 Acetylation
K238 Ubiquitination
K241 Ubiquitination
S243 Phosphorylation
K245 Ubiquitination
S250 Phosphorylation
IMPORTANT: For western blots, incubate membrane with diluted antibody in 5% w/v milk , 1X TBS, 0.1% Tween®20 at 4°C with gentle shaking, overnight.

To Top